PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS10099504 to PF01458 (UPF0051)

VIMSS10099504 has 557 amino acids

Query:       UPF0051  [M=218]
Accession:   PF01458.17
Description: Uncharacterized protein family (UPF0051)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence      Description
    ------- ------ -----    ------- ------ -----   ---- --  --------      -----------
    2.1e-70  222.9   0.2    2.8e-70  222.5   0.2    1.2  1  VIMSS10099504  


Domain annotation for each sequence (and alignments):
>> VIMSS10099504  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  222.5   0.2   2.8e-70   2.8e-70       2     218 .]     295     528 ..     294     528 .. 0.96

  Alignments for each domain:
  == domain 1  score: 222.5 bits;  conditional E-value: 2.8e-70
        UPF0051   2 qfertlivveegaevtiieeyagc............gvveifvgenAklkyvkvqnw.......sedavnlstkra.eegrdaklelttvslggkl 77 
                    qfertliv+eeg+ v+++   +gc            +vve++ g++A++ky++vqnw       +++++n++tkr    g ++k+++t+v++g+++
  VIMSS10099504 295 QFERTLIVAEEGSFVEYL---EGCtapsydtnqlhaAVVELYCGKGAEIKYSTVQNWyagdeqgKGGIYNFVTKRGlCAGDRSKISWTQVETGSAI 387
                    89****************...666667777777777***************************777**********66688*************** PP

        UPF0051  78 trkepsvelkgegaeaelnglylakgkqhldtrtkvdhngpntssrilskgvlkdearavfrgkikvrkgaqktdahqenrnLllsdkaradtiPe 173
                    t+k+psv+l+g+++ +e+++++l+++ q++dt+tk++h+g+nt+sri+skg++++++r+++rg ++v+ +a+++++  +++++l++dka a+t P+
  VIMSS10099504 388 TWKYPSVVLEGDDSVGEFYSVALTNNYQQADTGTKMIHKGKNTKSRIISKGISAGHSRNCYRGLVQVQSKAEGAKNTSTCDSMLIGDKAAANTYPY 483
                    ************************************************************************************************ PP

        UPF0051 174 leidaddvkasHgAtvGkideeqlfYLmsRGlseeeArrlivrgf 218
                    +++++  +k++H+A+++ki e+qlfY+++RG++ e A + ++ gf
  VIMSS10099504 484 IQVKNPSAKVEHEASTSKIGEDQLFYFQQRGIDHERALAAMISGF 528
                    ********************************************9 PP



Or compare VIMSS10099504 to CDD or PaperBLAST