PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS10108761 to PF01458 (UPF0051)

VIMSS10108761 has 470 amino acids

Query:       UPF0051  [M=218]
Accession:   PF01458.17
Description: Uncharacterized protein family (UPF0051)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence      Description
    ------- ------ -----    ------- ------ -----   ---- --  --------      -----------
    1.4e-32   99.2   0.4    9.4e-23   67.1   0.1    2.3  2  VIMSS10108761  


Domain annotation for each sequence (and alignments):
>> VIMSS10108761  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   31.9   0.1   5.5e-12   5.5e-12       2      95 ..     282     371 ..     281     374 .. 0.88
   2 !   67.1   0.1   9.4e-23   9.4e-23     147     218 .]     370     441 ..     368     441 .. 0.98

  Alignments for each domain:
  == domain 1  score: 31.9 bits;  conditional E-value: 5.5e-12
        UPF0051   2 qfertlivveegaevtiieeyagc............gvveifvgenAklkyvkvqnwsedavnlstkraeegrdaklelttvslggkltrkepsve 85 
                    qfertliv+eeg+ v++    +gc            +vve++ +e+A++ky+             t+    g ++k+++t+v+ g ++t+k+psv+
  VIMSS10108761 282 QFERTLIVAEEGSFVEYS---EGCtaishdknqlhaAVVELYCAEGAEIKYS-------------TRGLCAGDRSKISWTQVEKGFAITWKYPSVV 361
                    89****************...666666677777777***************9.............455567889********************** PP

        UPF0051  86 lkgegaeael 95 
                    l+g+++ +e 
  VIMSS10108761 362 LEGDDSVGEA 371
                    *****99886 PP

  == domain 2  score: 67.1 bits;  conditional E-value: 9.4e-23
        UPF0051 147 gaqktdahqenrnLllsdkaradtiPeleidaddvkasHgAtvGkideeqlfYLmsRGlseeeArrlivrgf 218
                    +a+++++  +++++l++d+a a+t P++++++  ++++H+A+++ki e+q+fY+++RG++ e A + ++ gf
  VIMSS10108761 370 EAENARNTSTCDSMLIGDNAAANTYPYIQVKNPSARIEHEASTSKIGEDQIFYFQQRGIDHERALAAMISGF 441
                    58999******************************************************************9 PP



Or compare VIMSS10108761 to CDD or PaperBLAST