PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS10341221 to PF01458 (UPF0051)

VIMSS10341221 has 481 amino acids

Query:       UPF0051  [M=218]
Accession:   PF01458.17
Description: Uncharacterized protein family (UPF0051)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence      Description
    ------- ------ -----    ------- ------ -----   ---- --  --------      -----------
    2.2e-75  239.2   0.0    2.7e-75  238.9   0.0    1.1  1  VIMSS10341221  


Domain annotation for each sequence (and alignments):
>> VIMSS10341221  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  238.9   0.0   2.7e-75   2.7e-75       2     218 .]     219     452 ..     218     452 .. 0.96

  Alignments for each domain:
  == domain 1  score: 238.9 bits;  conditional E-value: 2.7e-75
        UPF0051   2 qfertlivveegaevtiieeyagc............gvveifvgenAklkyvkvqnw.......sedavnlstkraee.grdaklelttvslggkl 77 
                    qfertliv+e+g+ v+++   +gc            +vve+++ e+A++ky++vqnw        ++++n++tkr ++ g+++k+++t+v++g+++
  VIMSS10341221 219 QFERTLIVAEAGSYVSYL---EGCtapqrdenqlhaAVVELIAMEDAEIKYSTVQNWypgdaegRGGIYNFVTKRGDCrGARSKISWTQVETGSAI 311
                    89****************...666667777777777**************************9777**********77588*************** PP

        UPF0051  78 trkepsvelkgegaeaelnglylakgkqhldtrtkvdhngpntssrilskgvlkdearavfrgkikvrkgaqktdahqenrnLllsdkaradtiPe 173
                    t+k+ps+ l+g+g+ +e+++++++kg+q++dt+tk++h g+ntss+i+skg++++e+ +++rg +++ ++a+++++h+++++Ll++d++ a+t+P+
  VIMSS10341221 312 TWKYPSCILRGDGSIGEFYSVAVTKGRQQADTGTKMIHIGRNTSSTIVSKGISAGEGSQTYRGLVRIGQRAEGARNHTQCDSLLIGDRCAANTVPY 407
                    ************************************************************************************************ PP

        UPF0051 174 leidaddvkasHgAtvGkideeqlfYLmsRGlseeeArrlivrgf 218
                    +e+++  +k++H+At++ki+++qlfY++sRGl+ee+A ++iv+gf
  VIMSS10341221 408 IEVKNPSAKMEHEATTSKISDDQLFYCRSRGLTEEDAVSMIVNGF 452
                    ********************************************9 PP



Or compare VIMSS10341221 to CDD or PaperBLAST