PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS105699 to PF01458 (UPF0051)

VIMSS105699 has 479 amino acids

Query:       UPF0051  [M=218]
Accession:   PF01458.17
Description: Uncharacterized protein family (UPF0051)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    3.7e-68  215.6   0.0    4.6e-68  215.2   0.0    1.1  1  VIMSS105699  


Domain annotation for each sequence (and alignments):
>> VIMSS105699  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  215.2   0.0   4.6e-68   4.6e-68       2     218 .]     222     448 ..     221     448 .. 0.96

  Alignments for each domain:
  == domain 1  score: 215.2 bits;  conditional E-value: 4.6e-68
      UPF0051   2 qfertlivveegaevtiieeyagc............gvveifvgenAklkyvkvqnwsedavnlstkraeegrdaklelttvslggkltrkepsvelk 87 
                  qfe+tl++++eg+ +++i   +gc            g+ve+++++nA +k++++qnws++++n+++kra  ++++++e++++slg+k +  +ps+ l+
  VIMSS105699 222 QFEHTLLIADEGSYIHFI---EGCtapqlkkysfhdGMVELYAKKNAYIKFTTIQNWSKNVINFNNKRAWADENSTVEWVEGSLGSKYSFVYPSTILR 316
                  89****************...666666666666667*********************************9999************************* PP

      UPF0051  88 gegaeaelnglylakgk.qhldtrtkvdhngpntssrilskgvlkdearavfrgkikvrkgaqktdahqenrnLllsdkaradtiPeleidaddvkas 184
                  g++a+++   +++++g+ +  d+++k++h++p t+s++++k++  +++ +v+rg +kv+kga +++a++++++L+l+dk +a+t P+ ++ ++d+ ++
  VIMSS105699 317 GKNASSTSLVVTMTSGEgEWKDSGSKMIHAAPYTKSKVVNKNIGFNGGVNVYRGLVKVNKGAVGSKAFVKCDSLMLDDKTKAYTYPHNQVLEEDADVG 414
                  *************9987589****************************************************************************** PP

      UPF0051 185 HgAtvGkideeqlfYLmsRGlseeeArrlivrgf 218
                  H+A + +++e+qlfYLm+RG++e+eA++++v gf
  VIMSS105699 415 HEAHTFRMNEDQLFYLMTRGIDEKEATSMLVLGF 448
                  ********************************99 PP



Or compare VIMSS105699 to CDD or PaperBLAST