PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS1140543 to PF01458 (UPF0051)

VIMSS1140543 has 513 amino acids

Query:       UPF0051  [M=218]
Accession:   PF01458.17
Description: Uncharacterized protein family (UPF0051)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------     -----------
    7.6e-73  230.9   0.0    9.5e-73  230.6   0.0    1.1  1  VIMSS1140543  


Domain annotation for each sequence (and alignments):
>> VIMSS1140543  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  230.6   0.0   9.5e-73   9.5e-73       2     218 .]     247     484 ..     246     484 .. 0.96

  Alignments for each domain:
  == domain 1  score: 230.6 bits;  conditional E-value: 9.5e-73
       UPF0051   2 qfertlivveegaevtiieeyagc............gvveifvgenAklkyvkvqnw.......sedavnlstkra....ee.grdaklelttvslg 74 
                   qfertli++++ga v+++   +gc            +vvei+v e+A++ky++vqnw        ++++n+  +r     ++ g+++k+ +t+v++g
  VIMSS1140543 247 QFERTLIIADKGAYVSYL---EGCtapkrdtnqlhaAVVEIVVLEDAEVKYSTVQNWypgdeegRGGIYNFRWTRKmpgpDCrGARSKVMWTQVETG 340
                   89****************...677777777777777**************************9777******9999899955488************ PP

       UPF0051  75 gkltrkepsvelkgegaeaelnglylakgkqhldtrtkvdhngpntssrilskgvlkdearavfrgkikvrkgaqktdahqenrnLllsdkaradti 171
                   +++t+k+ps+ l+g+++++e++++++a++ q++dt+tk++h g+nt+sri+skg+++++a++++rg + ++++a+++++++++++Ll++dk+ a+t+
  VIMSS1140543 341 SAITWKYPSCILRGDDSQGEFYSIAIANNAQQADTGTKMIHLGKNTRSRIVSKGISAGRAQNTYRGLVSMHPKATNSRNYTQCDSLLIGDKCGAHTV 437
                   ************************************************************************************************* PP

       UPF0051 172 PeleidaddvkasHgAtvGkideeqlfYLmsRGlseeeArrlivrgf 218
                   P++e++++  +++H+At++k+d++qlfY++sRG++eeeA +l+v+gf
  VIMSS1140543 438 PYIEVKNNSSRVEHEATTSKVDDDQLFYCRSRGMDEEEAVALVVNGF 484
                   **********************************************9 PP



Or compare VIMSS1140543 to CDD or PaperBLAST