PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS116354 to PF01458 (UPF0051)

VIMSS116354 has 420 amino acids

Query:       UPF0051  [M=218]
Accession:   PF01458.17
Description: Uncharacterized protein family (UPF0051)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    3.3e-62  196.1   0.3    4.4e-62  195.7   0.3    1.2  1  VIMSS116354  


Domain annotation for each sequence (and alignments):
>> VIMSS116354  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  195.7   0.3   4.4e-62   4.4e-62       3     218 .]     167     392 ..     165     392 .. 0.98

  Alignments for each domain:
  == domain 1  score: 195.7 bits;  conditional E-value: 4.4e-62
      UPF0051   3 fertlivveegaevtiieey..........agcgvveifvgenAklkyvkvqnwsedavnlstkraeegrdaklelttvslggkltrkepsvelkgeg 90 
                  +++++i+v+++++++++e++          + +  ve+++  +A++k+  +++ +e+++ + ++r ++g+da++++  + +++++++++++++l g+g
  VIMSS116354 167 NKHIMIIVGKNSKISYLERLesrgegsdkaTANITVEVIARSGAQVKFAAIDRLGENVTAYISRRGKLGNDASIDWAIGVMNEGNVVADFDSDLIGNG 264
                  78999************99999888888776679**************************************************************** PP

      UPF0051  91 aeaelnglylakgkqhldtrtkvdhngpntssrilskgvlkdearavfrgkikvrkgaqktdahqenrnLllsdkaradtiPeleidaddvkasHgAt 188
                  ++a+l+ ++l++g+q + ++t+v+  g n+ ++il +gv+ ++a+ +f+g  ++ kga+++da+qe+r+L+lsd+ar+d++P+l id++dv+a+H+A+
  VIMSS116354 265 SHADLKVVALSSGRQVQGIDTRVTNYGCNSIGNILQHGVILEKATLTFNGIGHIIKGAKGADAQQESRVLMLSDQARSDANPILLIDENDVTAGHAAS 362
                  ************************************************************************************************** PP

      UPF0051 189 vGkideeqlfYLmsRGlseeeArrlivrgf 218
                  +G++d e ++YLmsRGl++++A+rl+vrgf
  VIMSS116354 363 IGQVDPEDMYYLMSRGLDKATAERLVVRGF 392
                  *****************************9 PP



Or compare VIMSS116354 to CDD or PaperBLAST