PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS120882 to PF01458 (UPF0051)

VIMSS120882 has 466 amino acids

Query:       UPF0051  [M=218]
Accession:   PF01458.17
Description: Uncharacterized protein family (UPF0051)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    6.9e-78  247.4   0.1      9e-78  247.0   0.1    1.2  1  VIMSS120882  


Domain annotation for each sequence (and alignments):
>> VIMSS120882  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  247.0   0.1     9e-78     9e-78       2     218 .]     214     439 ..     213     439 .. 0.97

  Alignments for each domain:
  == domain 1  score: 247.0 bits;  conditional E-value: 9e-78
      UPF0051   2 qfertlivveegaevtiieeyagc............gvveifvgenAklkyvkvqnwsedavnlstkraeegrdaklelttvslggkltrkepsvelk 87 
                  qfe+tli+ve+ga +++i   +gc            g ve++v+e+A+l+y++++nws++++nl+tkra ++++ ++e++++s+g+k+++ +p + lk
  VIMSS120882 214 QFEHTLIIVEKGATLHFI---EGCsapkynvtnlhaGCVELYVKEDATLRYSTIENWSKNMLNLNTKRAVVEKNGTIEWVSGSFGSKISMLYPMSILK 308
                  89****************...666666677777777************************************************************** PP

      UPF0051  88 gegaeaelnglylakgkqhldtrtkvdhngpntssrilskgvlkdearavfrgkikvrkgaqktdahqenrnLllsdkaradtiPeleidaddvkasH 185
                  gega++e +g+++a+++qhldt+tkv h++p tss+i +k+++k++++ ++rg +kv+++a+++++++++++L+l+d +++dtiP l   +d+v ++H
  VIMSS120882 309 GEGAKSEYTGVTFAGEGQHLDTGTKVVHAAPYTSSTISAKSISKGGGTCIYRGSVKVTENAHHCKSSVSCDSLMLDDISQSDTIPALDLANDEVDIGH 406
                  ************************************************************************************************** PP

      UPF0051 186 gAtvGkideeqlfYLmsRGlseeeArrlivrgf 218
                  +A +G+i+++++fYLmsRG+se+eAr++ivrgf
  VIMSS120882 407 EAKIGRISDDAIFYLMSRGVSEDEARAMIVRGF 439
                  ********************************9 PP



Or compare VIMSS120882 to CDD or PaperBLAST