PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS120883 to PF01458 (UPF0051)

VIMSS120883 has 366 amino acids

Query:       UPF0051  [M=218]
Accession:   PF01458.17
Description: Uncharacterized protein family (UPF0051)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    2.6e-64  203.0   2.4    3.7e-64  202.5   2.4    1.2  1  VIMSS120883  


Domain annotation for each sequence (and alignments):
>> VIMSS120883  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  202.5   2.4   3.7e-64   3.7e-64       4     217 ..     116     337 ..     113     338 .. 0.98

  Alignments for each domain:
  == domain 1  score: 202.5 bits;  conditional E-value: 3.7e-64
      UPF0051   4 ertlivveegaevtiieey........agcgvveifvgenAklkyvkvqnwsedavnlstkraeegrdaklelttvslggkltrkepsvelkgegaea 93 
                   ++li++eeg+e+t++ +y        +++g ++i++++n+ +++vk+q+ s+++++l+ + ++ +++a +++t+v lg+k ++++++ +l+g +++a
  VIMSS120883 116 DNNLIIAEEGSEITVVVNYdsdenttsFHNGLTQIYAKANSVVNLVKIQTLSGSSLHLDAHTVKTEENAVVNYTAVDLGSKYAVTNYTDDLSGFRSSA 213
                  6899************99999999999999******************************************************************** PP

      UPF0051  94 elnglylakgkqhldtrtkvdhngpntssrilskgvlkdearavfrgkikvrkgaqktdahqenrnLllsdkaradtiPeleidaddvkasHgAtvGk 191
                  +++++yl+++++ +d++++++h g++++s+i ++g+l d+++++frg+++++kg++k+++++e+ + lls+++ ++++P+l ++++dv  +H+A+ G+
  VIMSS120883 214 NVKSIYLGDKDRVIDINYLINHYGKDARSNIETRGALMDRSKKTFRGTLDFKKGCKKSKGEEEEYTVLLSPHVINKSVPILLCTEEDVDGQHAASAGR 311
                  ************************************************************************************************** PP

      UPF0051 192 ideeqlfYLmsRGlseeeArrlivrg 217
                  ide++lfY msRG+se eA++l++++
  VIMSS120883 312 IDENKLFYIMSRGFSETEAKKLVIEA 337
                  ***********************987 PP



Or compare VIMSS120883 to CDD or PaperBLAST