PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS124408 to PF01458 (UPF0051)

VIMSS124408 has 425 amino acids

Query:       UPF0051  [M=218]
Accession:   PF01458.17
Description: Uncharacterized protein family (UPF0051)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    3.2e-68  215.8   0.0    4.7e-68  215.2   0.0    1.2  1  VIMSS124408  


Domain annotation for each sequence (and alignments):
>> VIMSS124408  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  215.2   0.0   4.7e-68   4.7e-68       4     218 .]     173     395 ..     170     395 .. 0.96

  Alignments for each domain:
  == domain 1  score: 215.2 bits;  conditional E-value: 4.7e-68
      UPF0051   4 ertlivveegaevtiieey........agcgvveifvgenAklkyvkvqnwsedavnlstkraeegrdaklelttvslggkltrkepsvelkgegaea 93 
                   r  + +++ga++t+ie++        +  +v+++ ++++A +  + +q+++   ++l + r ++g+dakl+l+ ++ ggkl+r+e++ + +geg+++
  VIMSS124408 173 TRFPVSFGAGAKATVIERHlstnaepsFVSSVSDVTLADGADVIWIILQQQGPADTHLGQIRFDLGKDAKLHLFVINAGGKLVRQELHGRASGEGSDL 270
                  5566899************96655555444******************************************************************** PP

      UPF0051  94 elnglylakgkqhldtrtkvdhngpntssrilskgvlkdearavfrgkikvrkgaqktdahqenrnLllsdkaradtiPeleidaddvkasHgAtvGk 191
                  +l+g+ l++g++h d+++++ h++p+t+s  ++++v+ d+a++vf+gki+v+++aqktda++++++Lllsd+a  +++Pelei+addv+++HgAtv  
  VIMSS124408 271 TLRGINLLGGDSHTDLTFTLSHDVPHTTSSEIIRNVVFDRAKGVFQGKILVAQDAQKTDAKMSCNTLLLSDDADFSAKPELEIFADDVQCGHGATVID 368
                  ************************************************************************************************** PP

      UPF0051 192 ideeqlfYLmsRGlseeeArrlivrgf 218
                  id  qlfYL +RG++e++Ar+++v++f
  VIMSS124408 369 IDHTQLFYLLARGIPENKARAMLVNAF 395
                  **************************9 PP



Or compare VIMSS124408 to CDD or PaperBLAST