PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS124410 to PF01458 (UPF0051)

VIMSS124410 has 489 amino acids

Query:       UPF0051  [M=218]
Accession:   PF01458.17
Description: Uncharacterized protein family (UPF0051)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    1.3e-71  226.8   0.1    1.7e-71  226.5   0.1    1.1  1  VIMSS124410  


Domain annotation for each sequence (and alignments):
>> VIMSS124410  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  226.5   0.1   1.7e-71   1.7e-71       2     218 .]     227     460 ..     226     460 .. 0.96

  Alignments for each domain:
  == domain 1  score: 226.5 bits;  conditional E-value: 1.7e-71
      UPF0051   2 qfertlivveegaevtiieeyagc............gvveifvgenAklkyvkvqnw.......sedavnlstkraee.grdaklelttvslggkltr 79 
                  qfertli+++ega v+++   +gc            +vve+++ ++A++ky++vqnw       +++++n++tkr ++ g+++k+++t+v++g+++t+
  VIMSS124410 227 QFERTLIIADEGAYVSYL---EGCtapqrdenqlhaAVVELIALDDAEIKYSTVQNWypgdkqgKGGIYNFVTKRGDCrGKNSKISWTQVETGSAITW 321
                  89****************...666667777777777***************************777**********77588***************** PP

      UPF0051  80 kepsvelkgegaeaelnglylakgkqhldtrtkvdhngpntssrilskgvlkdearavfrgkikvrkgaqktdahqenrnLllsdkaradtiPeleid 177
                  k+ps+ l+g+g+++e++++++++g+q++d++tk++h g+ntssri+skg++++ +++++rg++  +++a+++++++++++Ll++d++ a+t+P++e++
  VIMSS124410 322 KYPSCILRGDGSRGEFYSIAVSNGHQQIDSGTKMIHLGKNTSSRIISKGIAAGVSENTYRGQVSAHRKAENARNFTQCDSLLIGDRCGAHTVPYIEAK 419
                  ************************************************************************************************** PP

      UPF0051 178 addvkasHgAtvGkideeqlfYLmsRGlseeeArrlivrgf 218
                  +  ++ +H+At++ki+e+qlfY+ +RG++ee A +liv+gf
  VIMSS124410 420 NSTAQFEHEATTSKISEDQLFYCLQRGIPEEAAIALIVNGF 460
                  ****************************************9 PP



Or compare VIMSS124410 to CDD or PaperBLAST