PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS1247202 to PF01458 (UPF0051)

VIMSS1247202 has 470 amino acids

Query:       UPF0051  [M=218]
Accession:   PF01458.17
Description: Uncharacterized protein family (UPF0051)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------     -----------
    4.8e-77  244.6   0.2    7.4e-77  244.0   0.2    1.3  1  VIMSS1247202  


Domain annotation for each sequence (and alignments):
>> VIMSS1247202  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  244.0   0.2   7.4e-77   7.4e-77       2     218 .]     216     441 ..     215     441 .. 0.97

  Alignments for each domain:
  == domain 1  score: 244.0 bits;  conditional E-value: 7.4e-77
       UPF0051   2 qfertlivveegaevtiieeyagc............gvveifvgenAklkyvkvqnwsedavnlstkraeegrdaklelttvslggkltrkepsvel 86 
                   qfertli+v+ega v+++   +gc            +vvei+v++nA+++y+++qnws++++nl+tkra +++  ++e++++++g+k+t+k+p v l
  VIMSS1247202 216 QFERTLIIVDEGAYVHYV---EGCtapvyssdslhsAVVEIVVKKNARCRYTTIQNWSNNVYNLVTKRAACHEGGTMEWIDGNIGSKVTMKYPAVWL 309
                   89****************...677777777777777*************************************99********************** PP

       UPF0051  87 kgegaeaelnglylakgkqhldtrtkvdhngpntssrilskgvlkdearavfrgkikvrkgaqktdahqenrnLllsdkaradtiPeleidaddvka 183
                    ge+a++e+ ++++a+++qh+d + k+ h++p+tss+i+sk+v+++++r+++rg +++++g++ +++ +++++Ll++  +r+dt P++ +++dd+ +
  VIMSS1247202 310 LGEHAKGEVLSIAFAGAGQHQDAGAKMVHAAPRTSSTIVSKSVARGGGRTSYRGLVQINEGSSASRSTVKCDALLVDTVSRSDTYPYVDVREDDASI 406
                   ************************************************************************************************* PP

       UPF0051 184 sHgAtvGkideeqlfYLmsRGlseeeArrlivrgf 218
                   +H+A+v+k+ e+qlfYLmsRGlseeeA++++vrgf
  VIMSS1247202 407 GHEASVSKVGEDQLFYLMSRGLSEEEAMAMVVRGF 441
                   **********************************9 PP



Or compare VIMSS1247202 to CDD or PaperBLAST