PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS12863 to PF01458 (UPF0051)

VIMSS12863 has 480 amino acids

Query:       UPF0051  [M=218]
Accession:   PF01458.17
Description: Uncharacterized protein family (UPF0051)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence   Description
    ------- ------ -----    ------- ------ -----   ---- --  --------   -----------
    6.2e-73  231.2   0.2    7.8e-73  230.8   0.2    1.1  1  VIMSS12863  


Domain annotation for each sequence (and alignments):
>> VIMSS12863  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  230.8   0.2   7.8e-73   7.8e-73       2     218 .]     218     451 ..     217     451 .. 0.96

  Alignments for each domain:
  == domain 1  score: 230.8 bits;  conditional E-value: 7.8e-73
     UPF0051   2 qfertlivveegaevtiieeyagc............gvveifvgenAklkyvkvqnw.......sedavnlstkra.eegrdaklelttvslggkltrk 80 
                 qfertli++eega+v+++   +gc            +vve+++ +nA +ky++vqnw       +++++n++tkr   +g ++k+++t+v++g+++t+k
  VIMSS12863 218 QFERTLIIAEEGASVSYL---EGCtapmydtnqlhaAVVELVALDNADIKYSTVQNWyagdengKGGIYNFVTKRGlCKGVNSKISWTQVETGSAITWK 313
                 89****************...666667777777777**************************9777**********55577****************** PP

     UPF0051  81 epsvelkgegaeaelnglylakgkqhldtrtkvdhngpntssrilskgvlkdearavfrgkikvrkgaqktdahqenrnLllsdkaradtiPeleidad 179
                 +ps++l g+++ +e+++++l+++kq++dt+tk++h g+nt+s i+skg++++++ +++rg +k+ ++aq+++++ +++++l++d+a a+t+P++++d++
  VIMSS12863 314 YPSCVLVGDNSVGEFYSIALTNNKQQADTGTKMIHIGKNTRSIIISKGISAGNSANSYRGLVKMGPKAQGARNYSQCDSMLIGDRAAANTFPYIQVDNN 412
                 *************************************************************************************************** PP

     UPF0051 180 dvkasHgAtvGkideeqlfYLmsRGlseeeArrlivrgf 218
                  +k++H+A+++ki e+qlfY+ +RG+see+A +++v gf
  VIMSS12863 413 TAKVEHEASTSKIGEDQLFYFAQRGISEEDAVSMLVSGF 451
                 **************************************9 PP



Or compare VIMSS12863 to CDD or PaperBLAST