PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS12865 to PF01458 (UPF0051)

VIMSS12865 has 453 amino acids

Query:       UPF0051  [M=218]
Accession:   PF01458.17
Description: Uncharacterized protein family (UPF0051)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence   Description
    ------- ------ -----    ------- ------ -----   ---- --  --------   -----------
    9.3e-73  230.6   2.9    1.2e-72  230.2   2.9    1.1  1  VIMSS12865  


Domain annotation for each sequence (and alignments):
>> VIMSS12865  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  230.2   2.9   1.2e-72   1.2e-72       2     218 .]     195     427 ..     194     427 .. 0.96

  Alignments for each domain:
  == domain 1  score: 230.2 bits;  conditional E-value: 1.2e-72
     UPF0051   2 qfertlivveegaevtiieey................agcgvveifvgenAklkyvkvqnwsedavnlstkraeegrdaklelttvslggkltrkepsv 84 
                  ++r+l+vve++a+vti e+y                + + v+ei++genA++++++ q+ s+d+++++t+++ +g++++++l++v+lg+kl+r+++++
  VIMSS12865 195 VQPRLLVVVENNAQVTIAESYgaistnctdrpqqqpyFNNIVSEIYLGENAQVTHIRNQRDSGDSFHIATTAIAQGKQSRYRLIDVNLGAKLSRHNLQM 293
                 5799*******************98666666666666556*********************************************************** PP

     UPF0051  85 elkgegaeaelnglylakgkqhldtrtkvdhngpntssrilskgvlkdearavfrgkikvrkgaqktdahqenrnLllsdkaradtiPeleidaddvka 183
                  +++e +++e+  l++++g+q  dt++++ +n+p++ +++l+k+++++ a+avf gk++v ++aq t+a+q nrnL+ls+kar++t+Pel+i+ad+vk+
  VIMSS12865 294 TQQEEATKTEFLALTILAGRQVSDTHSTIALNHPHGATNQLHKCIVDEYAQAVFSGKVLVPQAAQLTNAQQLNRNLVLSSKARINTKPELQITADNVKC 392
                 *************************************************************************************************** PP

     UPF0051 184 sHgAtvGkideeqlfYLmsRGlseeeArrlivrgf 218
                 sHgAt+++++++++fYL+sRGl+  +Ar+l++ +f
  VIMSS12865 393 SHGATISQLEADEVFYLRSRGLNDYDARHLLIDAF 427
                 *********************************99 PP



Or compare VIMSS12865 to CDD or PaperBLAST