PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS148718 to PF01458 (UPF0051)

VIMSS148718 has 423 amino acids

Query:       UPF0051  [M=218]
Accession:   PF01458.17
Description: Uncharacterized protein family (UPF0051)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    9.2e-74  233.9   3.9    1.2e-73  233.6   3.9    1.1  1  VIMSS148718  


Domain annotation for each sequence (and alignments):
>> VIMSS148718  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  233.6   3.9   1.2e-73   1.2e-73       3     218 .]     170     393 ..     168     393 .. 0.97

  Alignments for each domain:
  == domain 1  score: 233.6 bits;  conditional E-value: 1.2e-73
      UPF0051   3 fertlivveegaevtiieey........agcgvveifvgenAklkyvkvqnwsedavnlstkraeegrdaklelttvslggkltrkepsvelkgegae 92 
                  + r+++ + egae+t+ie+y        ++ + ++++v++nA+l++ k+  ++ ++++++++   ++ da+  ++++ lg+++ r++ s++l+ge+a+
  VIMSS148718 170 HYRHHLALAEGAEATVIEHYvsltaakhFTGARLTMNVADNAQLRHFKLAFENASSYHFAHNDLLLATDASAFSHSFLLGAAVLRHHSSSQLNGENAT 267
                  56788999************99887777666*********************************99******************************** PP

      UPF0051  93 aelnglylakgkqhldtrtkvdhngpntssrilskgvlkdearavfrgkikvrkgaqktdahqenrnLllsdkaradtiPeleidaddvkasHgAtvG 190
                  ++ln+l++  +++ +dtrt ++hn+  ++sr+l+k++++d++ravf+g i v+++a ktd++++n+nLll++ a++dt+P+lei+addvk+sHgAt+G
  VIMSS148718 268 LRLNSLAMPVKNEVCDTRTWLEHNKGYCNSRQLHKTIVSDKGRAVFNGLINVAQHAIKTDGQMTNNNLLLGKLAEVDTKPQLEIYADDVKCSHGATIG 365
                  ************************************************************************************************** PP

      UPF0051 191 kideeqlfYLmsRGlseeeArrlivrgf 218
                  +id+eq+fYL+sRG+ ++eAr++i+++f
  VIMSS148718 366 RIDDEQMFYLQSRGIRQQEARHMILYAF 393
                  **************************99 PP



Or compare VIMSS148718 to CDD or PaperBLAST