PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS15800 to PF01458 (UPF0051)

VIMSS15800 has 423 amino acids

Query:       UPF0051  [M=218]
Accession:   PF01458.17
Description: Uncharacterized protein family (UPF0051)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence   Description
    ------- ------ -----    ------- ------ -----   ---- --  --------   -----------
    1.6e-73  233.1   2.9      2e-73  232.8   2.9    1.1  1  VIMSS15800  


Domain annotation for each sequence (and alignments):
>> VIMSS15800  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  232.8   2.9     2e-73     2e-73       3     218 .]     170     393 ..     168     393 .. 0.97

  Alignments for each domain:
  == domain 1  score: 232.8 bits;  conditional E-value: 2e-73
     UPF0051   3 fertlivveegaevtiieey........agcgvveifvgenAklkyvkvqnwsedavnlstkraeegrdaklelttvslggkltrkepsvelkgegaea 93 
                 + r+++ + egae+t+ie++        ++ +  +i+v++nA+l+++k+  ++  +++++++   +++da+  ++++ lgg++ r+++s++l+ge++++
  VIMSS15800 170 HYRHHLDLAEGAEATVIEHFvslndarhFTGARFTINVAANAHLQHIKLAFENPLSHHFAHNDLLLAEDATAFSHSFLLGGAVLRHNTSTQLNGENSTL 268
                 5688899**********99998888777666*********************************99********************************* PP

     UPF0051  94 elnglylakgkqhldtrtkvdhngpntssrilskgvlkdearavfrgkikvrkgaqktdahqenrnLllsdkaradtiPeleidaddvkasHgAtvGki 192
                 ++n+l++  +++ +dtrt ++hn+  ++sr+l+k++++d++ravf+g i v+++a ktd++++n+nLl+++ a++dt+P+lei+addvk+sHgAtvG+i
  VIMSS15800 269 RINSLAMPVKNEVCDTRTWLEHNKGFCNSRQLHKTIVSDKGRAVFNGLINVAQHAIKTDGQMTNNNLLMGKLAEVDTKPQLEIYADDVKCSHGATVGRI 367
                 *************************************************************************************************** PP

     UPF0051 193 deeqlfYLmsRGlseeeArrlivrgf 218
                 d+eq+fYL+sRG+++++A+++i+++f
  VIMSS15800 368 DDEQIFYLRSRGINQQDAQQMIIYAF 393
                 ************************99 PP



Or compare VIMSS15800 to CDD or PaperBLAST