PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS1762451 to PF01458 (UPF0051)

VIMSS1762451 has 419 amino acids

Query:       UPF0051  [M=218]
Accession:   PF01458.17
Description: Uncharacterized protein family (UPF0051)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------     -----------
    6.7e-73  231.1   0.4    8.4e-73  230.8   0.4    1.1  1  VIMSS1762451  


Domain annotation for each sequence (and alignments):
>> VIMSS1762451  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  230.8   0.4   8.4e-73   8.4e-73       2     218 .]     163     387 ..     162     387 .. 0.98

  Alignments for each domain:
  == domain 1  score: 230.8 bits;  conditional E-value: 8.4e-73
       UPF0051   2 qfertlivveegaevtiieey........agcgvveifvgenAklkyvkvqnwsedavnlstkraeegrdaklelttvslggkltrkepsvelkgeg 90 
                    ++r+ + v++ ++v ++e++        + ++v++++vge+Akl yv+vq +se+avn+ ++r  +++da++e+ ++ +g++l+r++++v l+g+g
  VIMSS1762451 163 VNPRLSLDVGARSSVRVLESHygkagttyFANSVSDVHVGESAKLVYVRVQAESESAVNIGRTRLVVEKDANVESLAFATGARLSRHSLDVILNGPG 259
                   5789999***********99999988888778***************************************************************** PP

       UPF0051  91 aeaelnglylakgkqhldtrtkvdhngpntssrilskgvlkdearavfrgkikvrkgaqktdahqenrnLllsdkaradtiPeleidaddvkasHgA 187
                   +++e+ g+y ++g+qh+d++++++h++ ++++++l+kg+l++e+ravf g+++++kgaqk+++ q n+nLlls ka+ad++P l+i+addvka Hg+
  VIMSS1762451 260 SNTEILGVYAVRGNQHVDNTSLINHKVGECNTNQLYKGILDGESRAVFCGTVRIEKGAQKANSAQLNNNLLLSGKAEADSKPCLQIYADDVKAAHGS 356
                   ************************************************************************************************* PP

       UPF0051 188 tvGkideeqlfYLmsRGlseeeArrlivrgf 218
                   tvG+++ e+lfYL+sR +++e+A  ++ +g+
  VIMSS1762451 357 TVGQLNREELFYLQSRAIPKEKAIPMLSYGY 387
                   ***************************9986 PP



Or compare VIMSS1762451 to CDD or PaperBLAST