PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS1843722 to PF01458 (UPF0051)

VIMSS1843722 has 450 amino acids

Query:       UPF0051  [M=218]
Accession:   PF01458.17
Description: Uncharacterized protein family (UPF0051)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------     -----------
    1.8e-78  249.3   0.6    3.4e-78  248.4   0.7    1.4  2  VIMSS1843722  


Domain annotation for each sequence (and alignments):
>> VIMSS1843722  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   -3.5   0.0      0.37      0.37      67     110 ..      75     119 ..      62     123 .. 0.74
   2 !  248.4   0.7   3.4e-78   3.4e-78       3     218 .]     199     422 ..     197     422 .. 0.96

  Alignments for each domain:
  == domain 1  score: -3.5 bits;  conditional E-value: 0.37
       UPF0051  67 elttvslggkltrkepsvelkge.gaeaelnglylakgkqhldtr 110
                   +lt+  +g++l+++ p+v+++ e  ae++ +g+++++ k  ++++
  VIMSS1843722  75 RLTSTDVGAYLVLDGPDVVYATElPAELREKGVIFTDLKTAVEQH 119
                   567778888888888888776552578888888888877777666 PP

  == domain 2  score: 248.4 bits;  conditional E-value: 3.4e-78
       UPF0051   3 fertlivveegaevtiieey........agc.gvveifvgenAklkyvkvqnwsedavnlstkraeegrdaklelttvslggkltrkepsvelkgeg 90 
                   + rtl+v+ee+a+vt+i+e             g ve++v+++A+l+yv++qnw++++++++++r +++rda+l++  v++gg l+r+e++++l+g+g
  VIMSS1843722 199 ATRTLVVAEENAQVTFIDEQdsedlpgtY-AiGAVELVVKQGARLRYVSIQNWGKGVTHIQRQRGDVHRDATLNSLVVTMGGTLSRTEMQSYLRGQG 294
                   579**************777665555542.16***************************************************************** PP

       UPF0051  91 aeaelnglylakgkqhldtrtkvdhngpntssrilskgvlkdearavfrgkikvrkgaqktdahqenrnLllsdkaradtiPeleidaddvkasHgA 187
                   +++e+ gly+a+++qh+d+ t+ +h++p+++s++l+kgv +d++ +vf g+ikv  gaqktda+q++r+L+ls++a+++++P+lei+a+dv++sHg+
  VIMSS1843722 295 SDSEMLGLYFASKDQHFDHYTLQHHAAPHAHSDLLYKGVNADQSVGVFSGMIKVDLGAQKTDAYQKHRTLMLSSEAQNYSVPQLEINANDVRCSHGS 391
                   ************************************************************************************************* PP

       UPF0051 188 tvGkideeqlfYLmsRGlseeeArrlivrgf 218
                   t+G +++e+lf L+sRG+ +e A++++v +f
  VIMSS1843722 392 TTGPVNQEALFFLRSRGIHKELAEKMLVTAF 422
                   ****************************998 PP



Or compare VIMSS1843722 to CDD or PaperBLAST