PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS1843723 to PF01458 (UPF0051)

VIMSS1843723 has 467 amino acids

Query:       UPF0051  [M=218]
Accession:   PF01458.17
Description: Uncharacterized protein family (UPF0051)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------     -----------
    7.1e-80  253.9   0.1    9.1e-80  253.5   0.1    1.1  1  VIMSS1843723  


Domain annotation for each sequence (and alignments):
>> VIMSS1843723  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  253.5   0.1   9.1e-80   9.1e-80       2     218 .]     213     438 ..     212     438 .. 0.97

  Alignments for each domain:
  == domain 1  score: 253.5 bits;  conditional E-value: 9.1e-80
       UPF0051   2 qfertlivveegaevtiieeyagc............gvveifvgenAklkyvkvqnwsedavnlstkraeegrdaklelttvslggkltrkepsvel 86 
                   qfertli+v+ega++++i   +gc            gv+ei+v+e+A+++y+++qnws++++nl+t+ra + r+  +e+++++lg+k+t+k+p ++l
  VIMSS1843723 213 QFERTLIIVDEGAQAHYI---EGCtaptyasdsfhsGVIEIIVKEGARFRYSTIQNWSHNVYNLVTQRAAVYRNGVMEWVDGNLGSKVTMKYPACYL 306
                   89****************...555555666666666************************************************************* PP

       UPF0051  87 kgegaeaelnglylakgkqhldtrtkvdhngpntssrilskgvlkdearavfrgkikvrkgaqktdahqenrnLllsdkaradtiPeleidaddvka 183
                    +ega++e+ ++++a+++qh+d + k+ h +p+ts++i+sk+++kd++r+++rg +k+ +ga ++++++e+++Lll+++ar dt P++ei+++d+ +
  VIMSS1843723 307 LEEGARGEVLSIAMAGRGQHQDAGAKIVHFAPHTSGTIVSKSISKDSGRSSYRGLVKIYEGAYGSKTNVECDALLLDEEARTDTYPYIEIEEKDASV 403
                   ************************************************************************************************* PP

       UPF0051 184 sHgAtvGkideeqlfYLmsRGlseeeArrlivrgf 218
                   +H+Atv+ki++eq+ YL+sRGlse+eA  livrgf
  VIMSS1843723 404 GHEATVSKINDEQILYLQSRGLSEDEAAGLIVRGF 438
                   **********************************9 PP



Or compare VIMSS1843723 to CDD or PaperBLAST