PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS188991 to PF01458 (UPF0051)

VIMSS188991 has 475 amino acids

Query:       UPF0051  [M=218]
Accession:   PF01458.17
Description: Uncharacterized protein family (UPF0051)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    1.5e-68  216.8   0.0    1.9e-68  216.5   0.0    1.1  1  VIMSS188991  


Domain annotation for each sequence (and alignments):
>> VIMSS188991  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  216.5   0.0   1.9e-68   1.9e-68       2     218 .]     219     444 ..     218     444 .. 0.97

  Alignments for each domain:
  == domain 1  score: 216.5 bits;  conditional E-value: 1.9e-68
      UPF0051   2 qfertlivveegaevtiieeyagc............gvveifvgenAklkyvkvqnwsedavnlstkraeegrdaklelttvslggkltrkepsvelk 87 
                  qfe+tli+++eg+ +++i   +gc            g+vei+++++A++k++++qnws++++n+++kra  + +a +e++++s+g+++t+++ps++lk
  VIMSS188991 219 QFEHTLIIADEGSYLHFI---EGCsapmykgfsfhdGMVEIYAHKDATVKFTTIQNWSRNVINFNNKRAIIEDNAYVEWIEGSIGSRITYTYPSSVLK 313
                  89****************...666666666777777*********************************9999************************* PP

      UPF0051  88 gegaeaelnglylakgkqhldtrtkvdhngpntssrilskgvlkdearavfrgkikvrkgaqktdahqenrnLllsdkaradtiPeleidaddvkasH 185
                  g+ga+++ + + l++g    dt+ k  h +pntss+i+sk+++++++ +++rg +++ kga ++ a +++++L+l+++++a+t P+ + d+  + + H
  VIMSS188991 314 GPGAKTTQYVVSLSNGPYLKDTGAKTWHLAPNTSSKIVSKSISANGGINIYRGLVRIMKGAINSTATVSCDSLILDKESKAYTYPHNQNDEPTASIIH 411
                  ************************************************************************************************** PP

      UPF0051 186 gAtvGkideeqlfYLmsRGlseeeArrlivrgf 218
                  +At+Gk++e++lfYL++RG++eeeA++liv gf
  VIMSS188991 412 EATTGKLSEDKLFYLKARGIKEEEAKSLIVLGF 444
                  *******************************99 PP



Or compare VIMSS188991 to CDD or PaperBLAST