PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS198626 to PF01458 (UPF0051)

VIMSS198626 has 432 amino acids

Query:       UPF0051  [M=218]
Accession:   PF01458.17
Description: Uncharacterized protein family (UPF0051)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
      2e-72  229.5   1.6    2.5e-72  229.2   1.6    1.1  1  VIMSS198626  


Domain annotation for each sequence (and alignments):
>> VIMSS198626  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  229.2   1.6   2.5e-72   2.5e-72       3     218 .]     179     402 ..     177     402 .. 0.99

  Alignments for each domain:
  == domain 1  score: 229.2 bits;  conditional E-value: 2.5e-72
      UPF0051   3 fertlivveegaevtiieey........agcgvveifvgenAklkyvkvqnwsedavnlstkraeegrdaklelttvslggkltrkepsvelkgegae 92 
                   +r+ ++v ++ +vt+ie++        +++ v+ei +g+ A l++v++q++s +a+++ ++++ +++d+++e +++ lgg l+r++ +v+++g+g++
  VIMSS198626 179 SPRLTVEVAAHGQVTLIERFlsltgdqqFTNTVTEISLGAAAGLHHVRIQHQSPTAIHIGSTAVCQAQDSAYEGHAIDLGGCLSRHHWQVQIQGSGSQ 276
                  57999******************99999999******************************************************************* PP

      UPF0051  93 aelnglylakgkqhldtrtkvdhngpntssrilskgvlkdearavfrgkikvrkgaqktdahqenrnLllsdkaradtiPeleidaddvkasHgAtvG 190
                  + l+gl++a ++q +dt++ v   +p+++s++++k++l d+a+++f+g++ v + aq tda+q nr+Lllsdkar+dt+P+lei ad+vk+sHgAtv+
  VIMSS198626 277 TILKGLAIAMDEQIVDTHSAVLFHAPHSRSEQIHKCILGDRAHGIFNGRVVVPQVAQLTDASQLNRTLLLSDKARVDTKPQLEIVADNVKCSHGATVS 374
                  ************************************************************************************************** PP

      UPF0051 191 kideeqlfYLmsRGlseeeArrlivrgf 218
                  ++++e +fYL+sRGl++ +Ar+l+v++f
  VIMSS198626 375 QLAAEDIFYLRSRGLDQHQARDLLVKAF 402
                  **************************99 PP



Or compare VIMSS198626 to CDD or PaperBLAST