PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS204268 to PF01458 (UPF0051)

VIMSS204268 has 479 amino acids

Query:       UPF0051  [M=218]
Accession:   PF01458.17
Description: Uncharacterized protein family (UPF0051)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    7.1e-69  217.9   0.0    9.5e-69  217.5   0.0    1.2  1  VIMSS204268  


Domain annotation for each sequence (and alignments):
>> VIMSS204268  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  217.5   0.0   9.5e-69   9.5e-69       2     218 .]     217     450 ..     216     450 .. 0.96

  Alignments for each domain:
  == domain 1  score: 217.5 bits;  conditional E-value: 9.5e-69
      UPF0051   2 qfertlivveegaevtiieeyagc............gvveifvgenAklkyvkvqnw.......sedavnlstkraee.grdaklelttvslggkltr 79 
                  qfertliv+eega+v+++   +gc            +vve+++ ++A++ky++vqnw        ++++n++tkr ++ g+++++++t+v++g+++t+
  VIMSS204268 217 QFERTLIVAEEGASVSYL---EGCtapmfdtnqlhaAVVELVALDDASIKYSTVQNWyagdedgVGGIYNFVTKRGQCrGARSRISWTQVETGSAITW 311
                  89****************...666667777777777*************************98777**********77588***************** PP

      UPF0051  80 kepsvelkgegaeaelnglylakgkqhldtrtkvdhngpntssrilskgvlkdearavfrgkikvrkgaqktdahqenrnLllsdkaradtiPeleid 177
                  k+ps++l+g ++ +e+++++l++++q++dt+tk+ h gp+t+s+i+skg++++++ +++rg +++ ++a++++++ +++++l++d+a a+t P++  +
  VIMSS204268 312 KYPSCVLQGADSVGEFYSVALTNNRQQADTGTKMVHVGPRTRSTIVSKGISAGHSSNSYRGLVQMGPAAKGARNYSQCDSMLIGDQAAANTYPYIRSQ 409
                  ************************************************************************************************** PP

      UPF0051 178 addvkasHgAtvGkideeqlfYLmsRGlseeeArrlivrgf 218
                  + ++ ++H+A++ +i+e+qlfYL+sRG+  eeA +++v gf
  VIMSS204268 410 QPQAAIEHEASTCRISEDQLFYLQSRGIGFEEAVSMMVSGF 450
                  ****************************************9 PP



Or compare VIMSS204268 to CDD or PaperBLAST