PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS2060803 to PF01458 (UPF0051)

VIMSS2060803 has 460 amino acids

Query:       UPF0051  [M=218]
Accession:   PF01458.17
Description: Uncharacterized protein family (UPF0051)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------     -----------
    5.7e-73  231.3   0.2    7.5e-73  230.9   0.2    1.2  1  VIMSS2060803  


Domain annotation for each sequence (and alignments):
>> VIMSS2060803  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  230.9   0.2   7.5e-73   7.5e-73       2     218 .]     206     431 ..     205     431 .. 0.97

  Alignments for each domain:
  == domain 1  score: 230.9 bits;  conditional E-value: 7.5e-73
       UPF0051   2 qfertlivveegaevtiieeyagc............gvveifvgenAklkyvkvqnwsedavnlstkraeegrdaklelttvslggkltrkepsvel 86 
                   qfer l+++eeg ++++i   +gc            ++vei+v+++A ++y+++qnws++++nl+t+r  +++  +le+++++lg+k+++k+p + l
  VIMSS2060803 206 QFERSLMIIEEGGSIQYI---EGCtaptytsnslhaANVEIIVKKDAFFRYTTIQNWSDNVYNLVTERGIVEEGGTLEWIDGNLGSKVNMKYPCSIL 299
                   899***************...666666666777777*********************************8899999********************* PP

       UPF0051  87 kgegaeaelnglylakgkqhldtrtkvdhngpntssrilskgvlkdearavfrgkikvrkgaqktdahqenrnLllsdkaradtiPeleidaddvka 183
                   +g++a++++ ++ +a+ +qhld + kv hn+p+tss+++sk+v+kd++++ +rg++++ k+++++++h+e++++l++ ++++dtiP  ei++ +v +
  VIMSS2060803 300 NGRNARTSVLSMSFANYGQHLDAGCKVFHNAPKTSSTLISKSVAKDGGKTDYRGQVRFGKNSAGSKSHIECDTILMDGESSSDTIPFNEIHNSNVAL 396
                   ************************************************************************************************* PP

       UPF0051 184 sHgAtvGkideeqlfYLmsRGlseeeArrlivrgf 218
                   +H+A v+k++e+ql+YLmsRG+seeeA+++i++gf
  VIMSS2060803 397 EHEAKVSKVSEDQLYYLMSRGISEEEATAMIINGF 431
                   **********************************9 PP



Or compare VIMSS2060803 to CDD or PaperBLAST