PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS2061484 to PF01458 (UPF0051)

VIMSS2061484 has 420 amino acids

Query:       UPF0051  [M=218]
Accession:   PF01458.17
Description: Uncharacterized protein family (UPF0051)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------     -----------
    1.5e-62  197.2   0.1      2e-62  196.8   0.1    1.1  1  VIMSS2061484  


Domain annotation for each sequence (and alignments):
>> VIMSS2061484  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  196.8   0.1     2e-62     2e-62       3     218 .]     167     392 ..     165     392 .. 0.98

  Alignments for each domain:
  == domain 1  score: 196.8 bits;  conditional E-value: 2e-62
       UPF0051   3 fertlivveegaevtiieey..........agcgvveifvgenAklkyvkvqnwsedavnlstkraeegrdaklelttvslggkltrkepsvelkge 89 
                   ++++li+++++++v+++e++          + +  ve++++++A++k++ +++ +e+++ + ++r ++++da++++  + +++++++++++++l g+
  VIMSS2061484 167 NKHILIIAGKHSKVNYLERLetygegsvpvTANITVEVIAQAGAQIKFSAIDRLGENVTAYISRRGKLDNDAMIDWAIGVMNEGNVVADFDSDLYGK 263
                   789**************9988889888887667**************************************************************** PP

       UPF0051  90 gaeaelnglylakgkqhldtrtkvdhngpntssrilskgvlkdearavfrgkikvrkgaqktdahqenrnLllsdkaradtiPeleidaddvkasHg 186
                   g++a+++ ++l++gkq + ++t+v+  g n+ ++il +gv+ ++++ +f+g  ++ kga+++da+qe+r+L+lsd+ar+d++P+l id++dv+a+H+
  VIMSS2061484 264 GSHADMKVVALSSGKQVQGIDTRVTNYGCNSIGNILQHGVILEKGTLTFNGIGHIIKGAKGADAQQESRVLMLSDQARSDANPILLIDENDVTAGHA 360
                   ************************************************************************************************* PP

       UPF0051 187 AtvGkideeqlfYLmsRGlseeeArrlivrgf 218
                   A++G++d e ++YLmsRGl++++A+rl+vrgf
  VIMSS2061484 361 ASIGQVDPEDMYYLMSRGLDKATAERLVVRGF 392
                   *******************************9 PP



Or compare VIMSS2061484 to CDD or PaperBLAST