PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS2127414 to PF01458 (UPF0051)

VIMSS2127414 has 470 amino acids

Query:       UPF0051  [M=218]
Accession:   PF01458.17
Description: Uncharacterized protein family (UPF0051)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------     -----------
    9.2e-79  250.2   1.2    1.3e-78  249.8   1.2    1.2  1  VIMSS2127414  


Domain annotation for each sequence (and alignments):
>> VIMSS2127414  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  249.8   1.2   1.3e-78   1.3e-78       2     218 .]     216     441 ..     215     441 .. 0.97

  Alignments for each domain:
  == domain 1  score: 249.8 bits;  conditional E-value: 1.3e-78
       UPF0051   2 qfertlivveegaevtiieeyagc............gvveifvgenAklkyvkvqnwsedavnlstkraeegrdaklelttvslggkltrkepsvel 86 
                   qfertli+veega+++++   +gc            +vveifv+e+  ++y+++qnws++++nl+tkra  +++a++e+++++lg+k+++k+p v+l
  VIMSS2127414 216 QFERTLIIVEEGASIQYV---EGCtaptysasslhaAVVEIFVEEGGYMRYSTIQNWSDNVYNLVTKRAAAEKNATVEWIDGNLGSKVSMKYPAVHL 309
                   89****************...666667777777777**********************************9************************** PP

       UPF0051  87 kgegaeaelnglylakgkqhldtrtkvdhngpntssrilskgvlkdearavfrgkikvrkgaqktdahqenrnLllsdkaradtiPeleidaddvka 183
                   +g+ga++++ ++++a+++q++dt+ k++hn+pntss i+sk+++k+++ + +rg++++ k+++k+ +h+e++++l++d +++dt+P  ei++ +v +
  VIMSS2127414 310 NGPGARGTMLSIAFAGANQNQDTGAKMIHNAPNTSSSIISKSIAKNGGAVNYRGQVTFGKNSKKSASHIECDTILMDDLSKSDTVPFNEIHNSQVAL 406
                   ************************************************************************************************* PP

       UPF0051 184 sHgAtvGkideeqlfYLmsRGlseeeArrlivrgf 218
                   +H+A v+ki+eeql+YLmsRGl+e+eA+++iv gf
  VIMSS2127414 407 EHEAKVSKISEEQLYYLMSRGLTEKEATDMIVMGF 441
                   **********************************9 PP



Or compare VIMSS2127414 to CDD or PaperBLAST