PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS2127418 to PF01458 (UPF0051)

VIMSS2127418 has 418 amino acids

Query:       UPF0051  [M=218]
Accession:   PF01458.17
Description: Uncharacterized protein family (UPF0051)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------     -----------
    7.7e-60  188.4   0.7      1e-59  187.9   0.7    1.2  1  VIMSS2127418  


Domain annotation for each sequence (and alignments):
>> VIMSS2127418  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  187.9   0.7     1e-59     1e-59       3     218 .]     166     391 ..     164     391 .. 0.97

  Alignments for each domain:
  == domain 1  score: 187.9 bits;  conditional E-value: 1e-59
       UPF0051   3 fertlivveegaevtiieey..........agcgvveifvgenAklkyvkvqnwsedavnlstkraeegrdaklelttvslggkltrkepsvelkge 89 
                   ++r+l++v+++a+v ++e++          + + vve++++++A++k+  +++ +++++  + +r   g +a++++  + +++++++++++++lkg+
  VIMSS2127418 166 NKRILLIVGKNAKVDYLERLetsgeqtakaTANLVVEVIAKAGAQVKFAAIDRLGKNVTASVIRRGLIGDNATVDWSVGVMNDGNVVADFDSDLKGN 262
                   7899*************9998878777776556*****************************999999***************************** PP

       UPF0051  90 gaeaelnglylakgkqhldtrtkvdhngpntssrilskgvlkdearavfrgkikvrkgaqktdahqenrnLllsdkaradtiPeleidaddvkasHg 186
                   g++++++ + +++g+q + ++t+v+  g n+ ++il +gv+ d+++ +f+   ++ kga+++da+q++++L+lsdk+r d++P+l id+++v+a+H+
  VIMSS2127418 263 GSHSQIKVVGISTGHQTQGIDTRVTNFGLNSVGHILQNGVILDKGTLTFNAIGHIIKGAKNADAQQSSHVLMLSDKGRGDANPILLIDENEVTAGHA 359
                   ************************************************************************************************* PP

       UPF0051 187 AtvGkideeqlfYLmsRGlseeeArrlivrgf 218
                   A+vG++dee lfYL+sRGl+ee+A+rl++rgf
  VIMSS2127418 360 ASVGQVDEEDLFYLQSRGLDEETAKRLVIRGF 391
                   *******************************9 PP



Or compare VIMSS2127418 to CDD or PaperBLAST