PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS2187107 to PF01458 (UPF0051)

VIMSS2187107 has 478 amino acids

Query:       UPF0051  [M=218]
Accession:   PF01458.17
Description: Uncharacterized protein family (UPF0051)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------     -----------
    5.7e-72  228.0   0.1    7.3e-72  227.7   0.1    1.1  1  VIMSS2187107  


Domain annotation for each sequence (and alignments):
>> VIMSS2187107  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  227.7   0.1   7.3e-72   7.3e-72       2     218 .]     216     449 ..     215     449 .. 0.96

  Alignments for each domain:
  == domain 1  score: 227.7 bits;  conditional E-value: 7.3e-72
       UPF0051   2 qfertlivveegaevtiieeyagc............gvveifvgenAklkyvkvqnw.......sedavnlstkra.eegrdaklelttvslggklt 78 
                   qfertliv+eeg++vt++   +gc            +vve++  +nA++ky++vqnw       +++++n++tkr   +g ++k+++t+v++g+++t
  VIMSS2187107 216 QFERTLIVAEEGSSVTYL---EGCtapmfdtnqlhaAVVELVTLDNAEIKYSTVQNWfagdengKGGIYNFVTKRGlCKGVNSKISWTQVETGSAIT 309
                   89****************...666667777777777**************************9777**********55577**************** PP

       UPF0051  79 rkepsvelkgegaeaelnglylakgkqhldtrtkvdhngpntssrilskgvlkdearavfrgkikvrkgaqktdahqenrnLllsdkaradtiPele 175
                   +k+ps++l g+++ +e+++++l+++kq++dt+tk+ h g+nt+s+i+skg++++++ +++rg +k+ +ga++++++ +++++l++d+a+a+t+P+++
  VIMSS2187107 310 WKYPSCVLVGDNSVGEFYSVALTNNKQQADTGTKMVHVGKNTRSTIISKGISAGNSANSYRGLVKMGPGAKGSRNYSQCDSMLIGDRAQANTFPYIQ 406
                   ************************************************************************************************* PP

       UPF0051 176 idaddvkasHgAtvGkideeqlfYLmsRGlseeeArrlivrgf 218
                   +d++ +k++H+A+++ki  +qlfY+ +RG+s e+A ++i+ gf
  VIMSS2187107 407 VDNNTAKVEHEASTSKIGVDQLFYFAQRGISPEDAVSMIISGF 449
                   ******************************************9 PP



Or compare VIMSS2187107 to CDD or PaperBLAST