PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS2249 to PF01458 (UPF0051)

VIMSS2249 has 464 amino acids

Query:       UPF0051  [M=218]
Accession:   PF01458.17
Description: Uncharacterized protein family (UPF0051)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence  Description
    ------- ------ -----    ------- ------ -----   ---- --  --------  -----------
    7.3e-77  244.0   0.0    9.4e-77  243.7   0.0    1.1  1  VIMSS2249  


Domain annotation for each sequence (and alignments):
>> VIMSS2249  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  243.7   0.0   9.4e-77   9.4e-77       2     218 .]     210     435 ..     209     435 .. 0.97

  Alignments for each domain:
  == domain 1  score: 243.7 bits;  conditional E-value: 9.4e-77
    UPF0051   2 qfertlivveegaevtiieeyagc............gvveifvgenAklkyvkvqnwsedavnlstkraeegrdaklelttvslggkltrkepsvelkge 89 
                qfe+t+iv+eeg+evt+i   +gc            g+vei+v+++Ak+ky+++qnws++++nl+tkr  ++++ +++++++slg++ t+ +p + lkg+
  VIMSS2249 210 QFEHTIIVAEEGSEVTFI---EGCsapryniinlhaGMVEIYVKKGAKVKYLTIQNWSKNTYNLNTKRSIVDEEGSMTWVSGSLGSQKTMLYPMTILKGK 306
                89****************...677777777777777*********************************8899999************************ PP

    UPF0051  90 gaeaelnglylakgkqhldtrtkvdhngpntssrilskgvlkdearavfrgkikvrkgaqktdahqenrnLllsdkaradtiPeleidaddvkasHgAtv 189
                ga+ae  ++++a+ +qh+dt++kv h +p tss + +k+++ +++ a +rg +k++k+a k++a++e+ +L+l++++++dt+P++e+++d + ++H+A +
  VIMSS2249 307 GARAESMSITYAGPGQHMDTGSKVVHLAPYTSSIVSAKSISLGGGWAFYRGLLKITKEAVKSKASVECAALMLDNRSKSDTVPIIEVETDRADVGHEARI 406
                **************************************************************************************************** PP

    UPF0051 190 GkideeqlfYLmsRGlseeeArrlivrgf 218
                G+i e+q+fYLmsRGlse+eA+++iv+gf
  VIMSS2249 407 GRIGEDQIFYLMSRGLSEQEAKAMIVKGF 435
                ****************************9 PP



Or compare VIMSS2249 to CDD or PaperBLAST