PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS2250 to PF01458 (UPF0051)

VIMSS2250 has 368 amino acids

Query:       UPF0051  [M=218]
Accession:   PF01458.17
Description: Uncharacterized protein family (UPF0051)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence  Description
    ------- ------ -----    ------- ------ -----   ---- --  --------  -----------
    2.6e-45  140.9   0.0    3.5e-45  140.4   0.0    1.1  1  VIMSS2250  


Domain annotation for each sequence (and alignments):
>> VIMSS2250  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  140.4   0.0   3.5e-45   3.5e-45       4     217 ..     131     343 ..     129     344 .. 0.96

  Alignments for each domain:
  == domain 1  score: 140.4 bits;  conditional E-value: 3.5e-45
    UPF0051   4 ertlivveegaevtiieey..agcgvveifvgenAklkyvkvqnwsedavnlstkraeegrdaklelttvslggkltrkepsvelkgegaeaelnglyla 101
                e++l+vve+ ae+  + +   + + v++i v++nA+lk+  ++    + + ++++ + +++ a+l l +++  g+    ++ v+l+ + ++a++++ ++ 
  VIMSS2250 131 ENVLVVVEKEAEIYKLSSTdrFRNTVMRILVKKNASLKFFNLDFF--GNFSFDNVFIVLEEGARLVLRDFKAFGYRKTGHILVKLN-KSSKADMKSFFYQ 227
                5789*********99977789899****************99988..6788899999999999************99999*****8.9************ PP

    UPF0051 102 kgkqhldtrtkvdhngpntssrilskgvlkdearavfrgkikvrkgaqktdahqenrnLllsdkaradtiPeleidaddvkasHgAtvGkideeqlfYLm 201
                +g+   d+ ++++ +g++++++++ +gv+++ +++vfrg ++v++g+++  a++++++L+ls++ar+d+iP l +d++dv+asH A+ +++de++lfYLm
  VIMSS2250 228 NGSGITDLLYLMRFEGEDAEGKLKGNGVVDGAGKIVFRGILDVKRGSKNIVAEETEHTLVLSPDARMDAIPSLWVDENDVTASHSASSSSLDEDELFYLM 327
                **************************************************************************************************** PP

    UPF0051 202 sRGlseeeArrlivrg 217
                +RG++e e ++livrg
  VIMSS2250 328 TRGVDEIESKKLIVRG 343
                ***************9 PP



Or compare VIMSS2250 to CDD or PaperBLAST