PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS242282 to PF01458 (UPF0051)

VIMSS242282 has 473 amino acids

Query:       UPF0051  [M=218]
Accession:   PF01458.17
Description: Uncharacterized protein family (UPF0051)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    1.8e-79  252.6   0.2    2.4e-79  252.2   0.2    1.2  1  VIMSS242282  


Domain annotation for each sequence (and alignments):
>> VIMSS242282  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  252.2   0.2   2.4e-79   2.4e-79       2     218 .]     219     444 ..     218     444 .. 0.97

  Alignments for each domain:
  == domain 1  score: 252.2 bits;  conditional E-value: 2.4e-79
      UPF0051   2 qfertlivveegaevtiieeyagc............gvveifvgenAklkyvkvqnwsedavnlstkraeegrdaklelttvslggkltrkepsvelk 87 
                  qfertli+v+ega v+++   +gc            +vvei+v++nA+++y+++qnws++++nl+tkra   + a++e++++++g+k+t+k+p v+l 
  VIMSS242282 219 QFERTLIIVDEGAYVHYV---EGCtapiyksdslhsAVVEIIVKKNARCRYTTIQNWSNNVYNLVTKRAVAYEGATMEWIDGNIGSKVTMKYPAVYLM 313
                  89****************...777777777777777*********************************9999************************* PP

      UPF0051  88 gegaeaelnglylakgkqhldtrtkvdhngpntssrilskgvlkdearavfrgkikvrkgaqktdahqenrnLllsdkaradtiPeleidaddvkasH 185
                  ge+a++e  ++++a+++qh+d ++k+ h +pntss+i+sk+v+++++r+++rg + + +ga+++++++ +++Ll++  +r+dt P++ +++ddv ++H
  VIMSS242282 314 GEHAKGETLSIAFAGEGQHQDAGSKMVHMAPNTSSNIVSKSVARGGGRTSYRGLVEIGEGAHGSKSNVLCDALLVDTISRSDTYPYVDVREDDVSMGH 411
                  ************************************************************************************************** PP

      UPF0051 186 gAtvGkideeqlfYLmsRGlseeeArrlivrgf 218
                  +Atv+k++e+qlfYLmsRGlse eA+++ivrgf
  VIMSS242282 412 EATVSKVSEDQLFYLMSRGLSEFEAMAMIVRGF 444
                  ********************************9 PP



Or compare VIMSS242282 to CDD or PaperBLAST