PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS26431 to PF01458 (UPF0051)

VIMSS26431 has 479 amino acids

Query:       UPF0051  [M=218]
Accession:   PF01458.17
Description: Uncharacterized protein family (UPF0051)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence   Description
    ------- ------ -----    ------- ------ -----   ---- --  --------   -----------
    1.8e-70  223.1   0.0    2.8e-70  222.5   0.0    1.3  1  VIMSS26431  


Domain annotation for each sequence (and alignments):
>> VIMSS26431  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  222.5   0.0   2.8e-70   2.8e-70       2     218 .]     225     450 ..     224     450 .. 0.97

  Alignments for each domain:
  == domain 1  score: 222.5 bits;  conditional E-value: 2.8e-70
     UPF0051   2 qfertlivveegaevtiieeyagc............gvveifvgenAklkyvkvqnwsedavnlstkraeegrdaklelttvslggkltrkepsvelkg 88 
                 qfe+tli+v+ega++++i   +gc            g ve++v++nA+l+y++++nws++ +nl+tkra +++d  +e++++s+g+++t+ +p + l+g
  VIMSS26431 225 QFEHTLIIVDEGASLHFI---EGCsapkyyknalhaGAVELYVKKNARLRYSTIENWSRNLYNLNTKRAIVDEDGVIEWISGSFGSRVTMLYPMSILRG 320
                 89****************...666677777777777*********************************99**************************** PP

     UPF0051  89 egaeaelnglylakgkqhldtrtkvdhngpntssrilskgvlkdearavfrgkikvrkgaqktdahqenrnLllsdkaradtiPeleidaddvkasHgA 187
                 +++++e++g+++a+++q+ldt+tk  h g+nt s++ +++++k++++a +rg + + ++a +++a  e+++L+l+++++ dtiP++ +++d+v ++H+A
  VIMSS26431 321 DRSRSEFTGITFASAGQYLDTGTKTVHLGRNTVSEVHARSISKNGGTANYRGLLSIGPKADGAKAVAECESLMLDNQSHTDTIPIIDVRTDNVDIGHEA 419
                 *************************************************************************************************** PP

     UPF0051 188 tvGkideeqlfYLmsRGlseeeArrlivrgf 218
                  +G+i++  +fYLm+RGl+e++A +livrgf
  VIMSS26431 420 KIGRISDRVVFYLMQRGLDEQTAISLIVRGF 450
                 ******************************9 PP



Or compare VIMSS26431 to CDD or PaperBLAST