PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS26432 to PF01458 (UPF0051)

VIMSS26432 has 382 amino acids

Query:       UPF0051  [M=218]
Accession:   PF01458.17
Description: Uncharacterized protein family (UPF0051)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence   Description
    ------- ------ -----    ------- ------ -----   ---- --  --------   -----------
    1.8e-49  154.5   0.0    2.5e-49  154.0   0.0    1.1  1  VIMSS26432  


Domain annotation for each sequence (and alignments):
>> VIMSS26432  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  154.0   0.0   2.5e-49   2.5e-49       5     217 ..     112     347 ..     106     348 .. 0.92

  Alignments for each domain:
  == domain 1  score: 154.0 bits;  conditional E-value: 2.5e-49
     UPF0051   5 rtlivveegaevtiieey.......................agcgvveifvgenAklkyvkvqnwsedavnlstkraeegrdaklelttvslggkltrk 80 
                 +t + ++ega+v+++  +                       + +g v + vg++A+++++kvqn + +avn++t++ + ++ a++++++v++g++++  
  VIMSS26432 112 QTFLDIQEGARVKVLVCVdaqgytpqdapalvgpqalerapFRNGLVSVQVGRGASVELIKVQNTHPTAVNFETVHLHAQESAQVRCYDVQIGAQISGV 210
                 5778899*****99933344444555555555555555556666**********************************99******************* PP

     UPF0051  81 epsvelkgegaeaelnglylakgkqhldtrtkvdhngpntssrilskgvlkdearavfrgkikvrkgaqktdahqenrnLllsdkaradtiPeleidad 179
                 ++s+ l+ e a++e++ ly+ ++ +++d++ +++ +g+n++++i + gv+kd+ar++frg+i  ++g++++ a+ + r++ll+++a   +iP + +d+d
  VIMSS26432 211 SNSAFLRDEWARVEIHPLYFIDKARRMDLEHNLIVEGKNSHAHICACGVVKDGARKTFRGNIFLHRGCSHSVARFSDRTILLDRTAVGVSIPTIFCDED 309
                 *************************************************************************************************** PP

     UPF0051 180 dvkasHgAtvGkideeqlfYLmsRGlseeeArrlivrg 217
                 dv  +H+A+   i  + l+YLmsRGl+e  A+rli+++
  VIMSS26432 310 DVVGEHAASFETIGSDVLYYLMSRGLDEYGAKRLIIEA 347
                 ************************************97 PP



Or compare VIMSS26432 to CDD or PaperBLAST