PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS274799 to PF01458 (UPF0051)

VIMSS274799 has 420 amino acids

Query:       UPF0051  [M=218]
Accession:   PF01458.17
Description: Uncharacterized protein family (UPF0051)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    4.1e-62  195.8   0.3    5.2e-62  195.5   0.3    1.1  1  VIMSS274799  


Domain annotation for each sequence (and alignments):
>> VIMSS274799  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  195.5   0.3   5.2e-62   5.2e-62       3     218 .]     167     392 ..     165     392 .. 0.98

  Alignments for each domain:
  == domain 1  score: 195.5 bits;  conditional E-value: 5.2e-62
      UPF0051   3 fertlivveegaevtiieey..........agcgvveifvgenAklkyvkvqnwsedavnlstkraeegrdaklelttvslggkltrkepsvelkgeg 90 
                  ++++l++v+++a+v+++e++          + +  ve+++++++++k+ ++++ +e+++ + ++r +  +da++++  + +++++++++++++l g+g
  VIMSS274799 167 NKHILLIVGKNAKVSYLERFesigdgtertSANISVEVIAQAGSQIKFASIDRLGENVTTFISRRGRHSSDATIDWALGVMNEGNVVADFDSDLIGDG 264
                  7899****************99999888876679*********************************9****************************** PP

      UPF0051  91 aeaelnglylakgkqhldtrtkvdhngpntssrilskgvlkdearavfrgkikvrkgaqktdahqenrnLllsdkaradtiPeleidaddvkasHgAt 188
                  ++a+l+ ++ ++g+q + ++t+v+  g n+ ++il +gv+ ++++ +f+g  ++ kga+++da+qe+r+L+lsdkar+d++P+l id++dv+a+H+A+
  VIMSS274799 265 SHANLKVVAASSGRQVQGIDTRVTNYGCNSVGHILQHGVILERGTLTFNGIGHIIKGAKGADAQQESRVLMLSDKARSDANPILLIDENDVTAGHAAS 362
                  ************************************************************************************************** PP

      UPF0051 189 vGkideeqlfYLmsRGlseeeArrlivrgf 218
                  +G++d e l+YLmsRGl++++A++l++rgf
  VIMSS274799 363 IGQVDPEDLYYLMSRGLNQKTAEQLVIRGF 392
                  *****************************9 PP



Or compare VIMSS274799 to CDD or PaperBLAST