PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS303855 to PF01458 (UPF0051)

VIMSS303855 has 508 amino acids

Query:       UPF0051  [M=218]
Accession:   PF01458.17
Description: Uncharacterized protein family (UPF0051)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    6.8e-73  231.1   0.2    8.6e-73  230.7   0.2    1.1  1  VIMSS303855  


Domain annotation for each sequence (and alignments):
>> VIMSS303855  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  230.7   0.2   8.6e-73   8.6e-73       2     218 .]     247     479 ..     246     479 .. 0.97

  Alignments for each domain:
  == domain 1  score: 230.7 bits;  conditional E-value: 8.6e-73
      UPF0051   2 qfertlivveegaevtiieeyagc............gvveifvgenAklkyvkvqnw......sedavnlstkra.eegrdaklelttvslggkltrk 80 
                  qfert++v++e++ v++i   +gc            +vve+++++nA++ky++vqnw       ++++n++tkra  eg+++k+++t+ ++g+++t+k
  VIMSS303855 247 QFERTILVADEDSYVSYI---EGCsapvrdsyqlhaAVVEVIIHKNAEVKYSTVQNWfpgdnnTGGILNFVTKRAlCEGENSKMSWTQSETGSAITWK 341
                  89****************...677777777777777*************************9777**********87799****************** PP

      UPF0051  81 epsvelkgegaeaelnglylakgkqhldtrtkvdhngpntssrilskgvlkdearavfrgkikvrkgaqktdahqenrnLllsdkaradtiPeleida 178
                  +ps+ l+g+++ +e+++++l++g+q++dt+tk++h g+nt+s+i+skg++++++++++rg +k+ + a++++++++++++l++ ++ a+t+P++e+++
  VIMSS303855 342 YPSCILRGDNSIGEFYSVALTSGHQQADTGTKMIHIGKNTKSTIISKGISAGHSQNSYRGLVKIMPTATNARNFTQCDSMLIGANCGAHTFPYVECRN 439
                  ************************************************************************************************** PP

      UPF0051 179 ddvkasHgAtvGkideeqlfYLmsRGlseeeArrlivrgf 218
                  + ++++H+At+++i e+qlfY+ +RG+see+A ++iv+gf
  VIMSS303855 440 NSAQLEHEATTSRIGEDQLFYCLQRGISEEDAISMIVNGF 479
                  ***************************************9 PP



Or compare VIMSS303855 to CDD or PaperBLAST