PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS3064853 to PF01458 (UPF0051)

VIMSS3064853 has 426 amino acids

Query:       UPF0051  [M=218]
Accession:   PF01458.17
Description: Uncharacterized protein family (UPF0051)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------     -----------
    4.6e-57  179.3   0.0    7.4e-57  178.6   0.0    1.3  1  VIMSS3064853  


Domain annotation for each sequence (and alignments):
>> VIMSS3064853  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  178.6   0.0   7.4e-57   7.4e-57       4     218 .]     169     392 ..     166     392 .. 0.96

  Alignments for each domain:
  == domain 1  score: 178.6 bits;  conditional E-value: 7.4e-57
       UPF0051   4 ertlivveegaevtiieey.........agcgvveifvgenAklkyvkvqnwsedavnlstkraeegrdaklelttvslggkltrkepsvelkgega 91 
                   +++l++ + g  +t++++            ++v ++++g +++l+   v++ +++ + + ++  ++g da++++  ++++ ++ + e+s+ l+g+g+
  VIMSS3064853 169 QHILFITGSGVTATVVQTTksspglekvQLNSVFDLIAGPGSRLDCFAVDQLNHSKISYFNRFSRLGVDAEVNWLLAEMNLNNLVGECSAILNGNGS 265
                   6999************777777777766667******************99999888888888999******************************* PP

       UPF0051  92 eaelnglylakgkqhldtrtkvdhngpntssrilskgvlkdearavfrgkikvrkgaqktdahqenrnLllsdkaradtiPeleidaddvkasHgAt 188
                   +a+l+ + la++kq++ + tk++h g++t+++i+ +gv+ +++r +++   k+ kga++++++q++r Llls++a+ d++P+l id++dv+a+H+A+
  VIMSS3064853 266 KANLRVVSLADRKQKQALMTKLIHIGQHTTGNINQRGVILQDGRLIYNAVGKIVKGAHGANSEQSSRILLLSPTATGDANPILLIDENDVEAGHAAS 362
                   ************************************************************************************************* PP

       UPF0051 189 vGkideeqlfYLmsRGlseeeArrlivrgf 218
                   +G+++ eql+YLmsRGl+ + Ar+l+v+gf
  VIMSS3064853 363 IGRVSPEQLYYLMSRGLTVDRARQLLVKGF 392
                   *****************************9 PP



Or compare VIMSS3064853 to CDD or PaperBLAST