PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS319550 to PF01458 (UPF0051)

VIMSS319550 has 498 amino acids

Query:       UPF0051  [M=218]
Accession:   PF01458.17
Description: Uncharacterized protein family (UPF0051)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    2.9e-69  219.2   0.1    3.7e-69  218.8   0.1    1.1  1  VIMSS319550  


Domain annotation for each sequence (and alignments):
>> VIMSS319550  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  218.8   0.1   3.7e-69   3.7e-69       2     218 .]     236     469 ..     235     469 .. 0.96

  Alignments for each domain:
  == domain 1  score: 218.8 bits;  conditional E-value: 3.7e-69
      UPF0051   2 qfertlivveegaevtiieeyagc............gvveifvgenAklkyvkvqnw.......sedavnlstkraee.grdaklelttvslggkltr 79 
                  qfertli++++g+ v+++   +gc            +vve++++++A++ky++vqnw       +++++n++tkr ++ g ++k+++t+v++g+++t+
  VIMSS319550 236 QFERTLIIADKGSYVSYL---EGCtapqrdenqlhaAVVELVAHDDAEIKYSTVQNWypgnsegKGGIYNFVTKRGDCrGDRSKISWTQVETGSAITW 330
                  89****************...666667777777777**************************9777**********77477***************** PP

      UPF0051  80 kepsvelkgegaeaelnglylakgkqhldtrtkvdhngpntssrilskgvlkdearavfrgkikvrkgaqktdahqenrnLllsdkaradtiPeleid 177
                  k+ps+ l+g+++++e++++++++g q++d++tk++h g+ntssri+skg++++++++++rg ++ +++a+++++++ +++Ll++dk+ a+t+P++e++
  VIMSS319550 331 KYPSCILRGDNSSGEFYSIAISNGFQQVDSGTKMIHLGKNTSSRIISKGIAAGKSQNTYRGLVTAHRKATGARNFTACDSLLIGDKCGAHTVPYIEAK 428
                  ************************************************************************************************** PP

      UPF0051 178 addvkasHgAtvGkideeqlfYLmsRGlseeeArrlivrgf 218
                  +  ++ +H+At++ki+e+ lfY+ +RGls+eeA  l+v+gf
  VIMSS319550 429 NSSATFEHEATTSKISEDVLFYCIQRGLSQEEAVGLVVNGF 469
                  ****************************************9 PP



Or compare VIMSS319550 to CDD or PaperBLAST