PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS330436 to PF01458 (UPF0051)

VIMSS330436 has 433 amino acids

Query:       UPF0051  [M=218]
Accession:   PF01458.17
Description: Uncharacterized protein family (UPF0051)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    1.1e-57  181.4   2.7    1.4e-57  180.9   2.7    1.1  1  VIMSS330436  


Domain annotation for each sequence (and alignments):
>> VIMSS330436  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  180.9   2.7   1.4e-57   1.4e-57       4     218 .]     180     402 ..     178     402 .. 0.97

  Alignments for each domain:
  == domain 1  score: 180.9 bits;  conditional E-value: 1.4e-57
      UPF0051   4 ertlivveegaevtiieey........agcgvveifvgenAklkyvkvqnwsedavnlstkraeegrdaklelttvslggkltrkepsvelkgegaea 93 
                   ++liv+e++++  + +++          + vvei + ++++++++  ++ + +++ + ++ra   r ak+++  + +++++t  ++++el  ega++
  VIMSS330436 180 SHVLIVAEQDSHFAVTQHLttkgdvdnIANCVVEILARADSEVHFSAFDELGANTTAYLNRRAAISRGAKVDWAIGMMNNGNTFGDFDSELISEGAKS 277
                  699*************888887777775569******************************************************************* PP

      UPF0051  94 elnglylakgkqhldtrtkvdhngpntssrilskgvlkdearavfrgkikvrkgaqktdahqenrnLllsdkaradtiPeleidaddvkasHgAtvGk 191
                  + + ++++++ q + ++t+v+ +g++t ++i+ +gv+ ++++ +f+g  ++ +ga++++a+qenr+L++sd+a+ d++P+l id++dv a+H+A+vG+
  VIMSS330436 278 DAKVITVTTKAQDVCVNTRVTNRGKKTDGNIVQRGVIMEKSNLIFNGIGHIIHGASGAHAEQENRVLMMSDDAHGDANPILLIDENDVLAGHAASVGQ 375
                  ************************************************************************************************** PP

      UPF0051 192 ideeqlfYLmsRGlseeeArrlivrgf 218
                  id++q++YLmsRG+++ +A+rl++rgf
  VIMSS330436 376 IDQNQMYYLMSRGIDKPQAQRLVIRGF 402
                  **************************9 PP



Or compare VIMSS330436 to CDD or PaperBLAST