PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS33234 to PF01458 (UPF0051)

VIMSS33234 has 846 amino acids

Query:       UPF0051  [M=218]
Accession:   PF01458.17
Description: Uncharacterized protein family (UPF0051)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence   Description
    ------- ------ -----    ------- ------ -----   ---- --  --------   -----------
    4.1e-77  244.8   0.1    2.5e-74  235.7   0.1    2.3  2  VIMSS33234  


Domain annotation for each sequence (and alignments):
>> VIMSS33234  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !    6.8   0.0   0.00026   0.00026       2      26 ..     233     261 ..     232     304 .. 0.74
   2 !  235.7   0.1   2.5e-74   2.5e-74      23     218 .]     622     817 ..     596     817 .. 0.95

  Alignments for each domain:
  == domain 1  score: 6.8 bits;  conditional E-value: 0.00026
     UPF0051   2 qfertlivveegaevtiieeyagc.......g 26 
                 qfertli+++eg+ v+++   +gc        
  VIMSS33234 233 QFERTLIIADEGSYVHYV---EGClpageliT 261
                 89****************...77755444440 PP

  == domain 2  score: 235.7 bits;  conditional E-value: 2.5e-74
     UPF0051  23 agcgvveifvgenAklkyvkvqnwsedavnlstkraeegrdaklelttvslggkltrkepsvelkgegaeaelnglylakgkqhldtrtkvdhngpnts 121
                 ++ +vvei+v+ +A+++y+++qnws++++nl+tkra+ ++ a++e++++++g+k+t+k+p v ++ge+a++e+ ++++a+++qh+dt+ k+ h +pnts
  VIMSS33234 622 LHSAVVEIIVKPHARVRYTTIQNWSNNVYNLVTKRARAEAGATMEWIDGNIGSKVTMKYPAVWMTGEHAKGEVLSVAFAGEDQHQDTGAKMLHLAPNTS 720
                 5669*********************************************************************************************** PP

     UPF0051 122 srilskgvlkdearavfrgkikvrkgaqktdahqenrnLllsdkaradtiPeleidaddvkasHgAtvGkideeqlfYLmsRGlseeeArrlivrgf 218
                 s+i+sk+v+++++r+++rg ++v+kga+++++++++++Ll++  +r+dt P++ i++ddv+++H+Atv+k++e+qlfYLmsRGl+e+eA++++vrgf
  VIMSS33234 721 SNIVSKSVARGGGRTSYRGLVQVNKGAHGSRSSVKCDALLVDTVSRSDTYPYVDIREDDVTMGHEATVSKVSENQLFYLMSRGLTEDEAMAMVVRGF 817
                 ************************************************************************************************9 PP



Or compare VIMSS33234 to CDD or PaperBLAST