PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS3459401 to PF01458 (UPF0051)

VIMSS3459401 has 434 amino acids

Query:       UPF0051  [M=218]
Accession:   PF01458.17
Description: Uncharacterized protein family (UPF0051)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------     -----------
    3.4e-76  241.9   1.0    4.3e-76  241.5   1.0    1.1  1  VIMSS3459401  


Domain annotation for each sequence (and alignments):
>> VIMSS3459401  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  241.5   1.0   4.3e-76   4.3e-76       4     218 .]     186     408 ..     183     408 .. 0.98

  Alignments for each domain:
  == domain 1  score: 241.5 bits;  conditional E-value: 4.3e-76
       UPF0051   4 ertlivveegaevtiieey........agcgvveifvgenAklkyvkvqnwsedavnlstkraeegrdaklelttvslggkltrkepsvelkgegae 92 
                   +r l+++e+++ +t+ieey        ++++v+e+ +g+nA+l++ ++q+++++a+++ t+ + ++rd+++ lt++slgg+++r++p v+ ++e+++
  VIMSS3459401 186 PRGLVIAEANSAATLIEEYaavnaasyFTNSVMEVSLGQNAQLHHHRIQREAKTAFHIGTTSVSQDRDSRYALTSLSLGGQMSRHNPVVVPTAEQTD 282
                   7889****************9999999889******************************************************************* PP

       UPF0051  93 aelnglylakgkqhldtrtkvdhngpntssrilskgvlkdearavfrgkikvrkgaqktdahqenrnLllsdkaradtiPeleidaddvkasHgAtv 189
                   ++lngl+la ++q +dt++ +   gp++++++l+k++++++aravf+g++ v k aq+t+a+q +rnLlls+kar+dt+P+lei addvk+ HgAtv
  VIMSS3459401 283 TTLNGLTLAVDQQVADTHSDLSFTGPHCTAQQLHKCIVDNRARAVFNGRVFVPKLAQQTNASQLSRNLLLSSKARVDTKPQLEIIADDVKCAHGATV 379
                   ************************************************************************************************* PP

       UPF0051 190 GkideeqlfYLmsRGlseeeArrlivrgf 218
                   +++d+e++fYL+sRGl+++ A +l+v+gf
  VIMSS3459401 380 SQLDDEEVFYLQSRGLDRNSACDLLVEGF 408
                   ****************************9 PP



Or compare VIMSS3459401 to CDD or PaperBLAST