PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS3459403 to PF01458 (UPF0051)

VIMSS3459403 has 478 amino acids

Query:       UPF0051  [M=218]
Accession:   PF01458.17
Description: Uncharacterized protein family (UPF0051)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------     -----------
    3.6e-71  225.4   0.1    4.5e-71  225.1   0.1    1.1  1  VIMSS3459403  


Domain annotation for each sequence (and alignments):
>> VIMSS3459403  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  225.1   0.1   4.5e-71   4.5e-71       2     218 .]     216     449 ..     215     449 .. 0.96

  Alignments for each domain:
  == domain 1  score: 225.1 bits;  conditional E-value: 4.5e-71
       UPF0051   2 qfertlivveegaevtiieeyagc............gvveifvgenAklkyvkvqnw.......sedavnlstkra.eegrdaklelttvslggklt 78 
                   qfertli++eeg++v+++   +gc            +vve+++ ++A +ky++vqnw       +++++n++tkr    g+++k+++t+v++g+++t
  VIMSS3459403 216 QFERTLIIAEEGSQVSYL---EGCtapmfdtnqlhaAVVELVALDDADIKYSTVQNWyagdengKGGIYNFVTKRGlCAGKNSKISWTQVETGSAIT 309
                   89****************...666667777777777**************************9777**********66699**************** PP

       UPF0051  79 rkepsvelkgegaeaelnglylakgkqhldtrtkvdhngpntssrilskgvlkdearavfrgkikvrkgaqktdahqenrnLllsdkaradtiPele 175
                   +k+ps++l g+++ +e+++++l+++kq++dt+tk++h g+nt+s+i+skg++++++++++rg +++ ++a +++++ +++++l++++a+a+t+P+++
  VIMSS3459403 310 WKYPSCVLVGDNSVGEFYSVALTNNKQQADTGTKMIHVGKNTRSTIISKGISAGRSQNSYRGLVRMGPKADGSRNYSQCDSMLIGSDAEANTFPYIQ 406
                   ************************************************************************************************* PP

       UPF0051 176 idaddvkasHgAtvGkideeqlfYLmsRGlseeeArrlivrgf 218
                   +++++ k++H+A+++ki e+qlfY+ +RG+s e+A ++++ gf
  VIMSS3459403 407 VQNNQTKVEHEASTSKIGEDQLFYFAQRGISVEDAVSMMISGF 449
                   ******************************************9 PP



Or compare VIMSS3459403 to CDD or PaperBLAST