PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS356532 to PF01458 (UPF0051)

VIMSS356532 has 464 amino acids

Query:       UPF0051  [M=218]
Accession:   PF01458.17
Description: Uncharacterized protein family (UPF0051)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    1.4e-78  249.6   0.9    1.9e-78  249.2   0.9    1.2  1  VIMSS356532  


Domain annotation for each sequence (and alignments):
>> VIMSS356532  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  249.2   0.9   1.9e-78   1.9e-78       2     218 .]     210     435 ..     209     435 .. 0.97

  Alignments for each domain:
  == domain 1  score: 249.2 bits;  conditional E-value: 1.9e-78
      UPF0051   2 qfertlivveegaevtiieeyagc............gvveifvgenAklkyvkvqnwsedavnlstkraeegrdaklelttvslggkltrkepsvelk 87 
                  qfertli+v+ega+v+++   +gc            ++veif  ++A ++y+++qnws++++nl+tkra+  + a++e+++++lg+k t+k+psv+l+
  VIMSS356532 210 QFERTLIIVDEGASVHYV---EGCtaptyssnslhaAIVEIFTRKDAYCRYTTIQNWSDNVYNLVTKRAKAYEGATVEWIDGNLGAKTTMKYPSVYLD 304
                  89****************...666666677777777************************************************************** PP

      UPF0051  88 gegaeaelnglylakgkqhldtrtkvdhngpntssrilskgvlkdearavfrgkikvrkgaqktdahqenrnLllsdkaradtiPeleidaddvkasH 185
                  g+ga++++ ++++a+++q +dt+ k++hn+pntss i+sk+++kd++++ +rg++++ k+++++ +h+e++++++++k+++dtiP  ei++ +v ++H
  VIMSS356532 305 GKGARGTMLSIAFAGANQIQDTGAKMIHNAPNTSSSIVSKSIAKDGGEVNYRGQVTFGKDSAGSISHIECDTIIMDEKSKSDTIPFNEIHNSQVSLEH 402
                  ************************************************************************************************** PP

      UPF0051 186 gAtvGkideeqlfYLmsRGlseeeArrlivrgf 218
                  +A v+ki+eeql+YLmsRGlse+eA+++iv gf
  VIMSS356532 403 EAKVSKISEEQLYYLMSRGLSEAEATEMIVMGF 435
                  ********************************9 PP



Or compare VIMSS356532 to CDD or PaperBLAST