PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS356535 to PF01458 (UPF0051)

VIMSS356535 has 428 amino acids

Query:       UPF0051  [M=218]
Accession:   PF01458.17
Description: Uncharacterized protein family (UPF0051)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    8.9e-66  207.8   0.3    1.2e-65  207.4   0.3    1.1  1  VIMSS356535  


Domain annotation for each sequence (and alignments):
>> VIMSS356535  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  207.4   0.3   1.2e-65   1.2e-65       3     218 .]     176     401 ..     174     401 .. 0.98

  Alignments for each domain:
  == domain 1  score: 207.4 bits;  conditional E-value: 1.2e-65
      UPF0051   3 fertlivveegaevtiieey..........agcgvveifvgenAklkyvkvqnwsedavnlstkraeegrdaklelttvslggkltrkepsvelkgeg 90 
                  f+++liv+++++e +++e++          +g+ vve++++++Ak+ky+ v++ +++++ + ++r    rda++++  + ++++ ++++++++l geg
  VIMSS356535 176 FKHVLIVADNHSEFSYLERFqstghhaekaSGNIVVEVIAKDGAKVKYSAVDQLGQTVTTYMNRRGYIMRDASVDWALGVMNDGDVVADFDSDLVGEG 273
                  79****************999999999888888***************************************************************** PP

      UPF0051  91 aeaelnglylakgkqhldtrtkvdhngpntssrilskgvlkdearavfrgkikvrkgaqktdahqenrnLllsdkaradtiPeleidaddvkasHgAt 188
                  a++e++ +++++gkq + ++t+v+ ++p++ ++il +gv++++++ +f+g  ++ kga+++da+qe+r+L+lsdkar d++P+l id+++v+a+H+A+
  VIMSS356535 274 AHSEVKVVAISAGKQTQGIDTRVTNKAPHSIGHILQHGVIRERGTLTFNGIGHILKGAKGADAQQESRVLMLSDKARGDANPILLIDENEVTAGHAAS 371
                  ************************************************************************************************** PP

      UPF0051 189 vGkideeqlfYLmsRGlseeeArrlivrgf 218
                  vG++d e+++YLmsRGl +eeA+rl++rgf
  VIMSS356535 372 VGRVDPEEMYYLMSRGLRKEEAERLVIRGF 401
                  *****************************9 PP



Or compare VIMSS356535 to CDD or PaperBLAST