PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS362191 to PF01458 (UPF0051)

VIMSS362191 has 430 amino acids

Query:       UPF0051  [M=218]
Accession:   PF01458.17
Description: Uncharacterized protein family (UPF0051)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    3.1e-65  206.0   0.7    4.8e-65  205.4   0.7    1.3  1  VIMSS362191  


Domain annotation for each sequence (and alignments):
>> VIMSS362191  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  205.4   0.7   4.8e-65   4.8e-65       3     218 .]     181     404 ..     179     404 .. 0.97

  Alignments for each domain:
  == domain 1  score: 205.4 bits;  conditional E-value: 4.8e-65
      UPF0051   3 fertlivveegaevtiieey........agcgvveifvgenAklkyvkvqnwsedavnlstkraeegrdaklelttvslggkltrkepsvelkgegae 92 
                  ++++l+v+++++ +t++e+y          + v e++v+++A++k+  v+  ++d++ ++++r  +grd ++++  + +++++t++e+ ++l g+g+ 
  VIMSS362191 181 YNHVLFVADANSTATYVENYvanenakgIANIVAEVIVEQGAQVKFGAVDLLAKDVTTYVNRRGVVGRDGRIDWALGLMNDGNTISENVTNLMGDGSY 278
                  6799****************87766666445******************************************************************* PP

      UPF0051  93 aelnglylakgkqhldtrtkvdhngpntssrilskgvlkdearavfrgkikvrkgaqktdahqenrnLllsdkaradtiPeleidaddvkasHgAtvG 190
                  a+ +++++++g+q ++ +tkv h g+++++ il +gv kd+a+++f+g  k+++ga+k++a+q++r+L+l++kar d++P+l id+ddv a+H+A+vG
  VIMSS362191 279 ADTKTVTIGRGNQTQNFTTKVVHFGKHSEGWILKHGVQKDSATSIFNGIGKIEHGASKSNAQQSSRVLMLDEKARGDANPILLIDEDDVMAGHAASVG 376
                  ************************************************************************************************** PP

      UPF0051 191 kideeqlfYLmsRGlseeeArrlivrgf 218
                  ++d  ql+YLmsRG++++eA+rl+++gf
  VIMSS362191 377 RVDPVQLYYLMSRGIPKREAERLVIHGF 404
                  ***************************9 PP



Or compare VIMSS362191 to CDD or PaperBLAST