PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS372530 to PF01458 (UPF0051)

VIMSS372530 has 479 amino acids

Query:       UPF0051  [M=218]
Accession:   PF01458.17
Description: Uncharacterized protein family (UPF0051)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    2.6e-67  212.8   0.0    3.3e-67  212.4   0.0    1.1  1  VIMSS372530  


Domain annotation for each sequence (and alignments):
>> VIMSS372530  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  212.4   0.0   3.3e-67   3.3e-67       2     218 .]     222     448 ..     221     448 .. 0.96

  Alignments for each domain:
  == domain 1  score: 212.4 bits;  conditional E-value: 3.3e-67
      UPF0051   2 qfertlivveegaevtiieeyagc............gvveifvgenAklkyvkvqnwsedavnlstkraeegrdaklelttvslggkltrkepsvelk 87 
                  qfe+tli+++eg+ +++i   +gc            g+ve+++++nA +k+++vqnws++++n+++kra  ++++++e++++slg+k +  +ps+ l+
  VIMSS372530 222 QFEHTLIIADEGSYIHFI---EGCsapqfkkfsfhdGMVELYAKKNAYIKFTTVQNWSKNVINFNNKRAWADENSTVEWVEGSLGSKYSFVYPSTILR 316
                  89****************...666666666666777*********************************9999************************* PP

      UPF0051  88 gegaeaelnglylakgk.qhldtrtkvdhngpntssrilskgvlkdearavfrgkikvrkgaqktdahqenrnLllsdkaradtiPeleidaddvkas 184
                  g++a+++   ++la+g+ +  d+++k++h++pnt+s++++k++  +++ +++rg i+v+kga++++a++++++L+l++k +a+t+P+ +++++d+ + 
  VIMSS372530 317 GRNASSTSLVVTLASGEgEWKDSGSKMIHAAPNTKSKVINKNIGFNGGVNIYRGLIRVNKGATGAKAFVKCDSLMLDEKTKAYTFPHNQVFEEDADVA 414
                  *************9987589****************************************************************************** PP

      UPF0051 185 HgAtvGkideeqlfYLmsRGlseeeArrlivrgf 218
                  H+A + +++e+qlfYLm RG++e+e  +++v gf
  VIMSS372530 415 HEAHTFRMNEDQLFYLMNRGIDEKESVSMLVLGF 448
                  ********************************99 PP



Or compare VIMSS372530 to CDD or PaperBLAST