PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS3727684 to PF01458 (UPF0051)

VIMSS3727684 has 493 amino acids

Query:       UPF0051  [M=218]
Accession:   PF01458.17
Description: Uncharacterized protein family (UPF0051)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------     -----------
    1.9e-69  219.8   0.0    2.4e-69  219.4   0.0    1.1  1  VIMSS3727684  


Domain annotation for each sequence (and alignments):
>> VIMSS3727684  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  219.4   0.0   2.4e-69   2.4e-69       2     218 .]     231     464 ..     230     464 .. 0.96

  Alignments for each domain:
  == domain 1  score: 219.4 bits;  conditional E-value: 2.4e-69
       UPF0051   2 qfertlivveegaevtiieeyagc............gvveifvgenAklkyvkvqnw.......sedavnlstkraee.grdaklelttvslggklt 78 
                   qfertli++++ga v+++   +gc            +vve++v ++A++ky++vqnw       +++++n++tkr ++ g+++k+++t+v++g+++t
  VIMSS3727684 231 QFERTLIIADKGAYVSYL---EGCtapqrdenqlhaAVVELVVLDDAEIKYSTVQNWypgdkdgKGGIYNFVTKRGDCrGANSKISWTQVETGSAIT 324
                   89****************...666667777777777***************************777**********77588**************** PP

       UPF0051  79 rkepsvelkgegaeaelnglylakgkqhldtrtkvdhngpntssrilskgvlkdearavfrgkikvrkgaqktdahqenrnLllsdkaradtiPele 175
                   +k+ps++l+g+g+++e++++++++g+q++d++tk++h g+ntssri+skg++++++++++rg +  +++a+++++++ +++Ll++d++ a+t+P++e
  VIMSS3727684 325 WKYPSCVLRGDGSQGEFYSIAISNGHQQVDSGTKMIHLGKNTSSRIVSKGISAGQSQNTYRGLVSAHRKAKGARNFTACDSLLIGDQCGAHTVPYIE 421
                   ************************************************************************************************* PP

       UPF0051 176 idaddvkasHgAtvGkideeqlfYLmsRGlseeeArrlivrgf 218
                   +++     +H+At++ki+e+ lfY+ +RGls+eeA  l+v+gf
  VIMSS3727684 422 AKNPTTVFEHEATTSKISEDVLFYCVQRGLSQEEAVGLVVNGF 464
                   ******************************************9 PP



Or compare VIMSS3727684 to CDD or PaperBLAST