PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS42748 to PF01458 (UPF0051)

VIMSS42748 has 468 amino acids

Query:       UPF0051  [M=218]
Accession:   PF01458.17
Description: Uncharacterized protein family (UPF0051)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence   Description
    ------- ------ -----    ------- ------ -----   ---- --  --------   -----------
    1.6e-79  252.7   0.1    2.1e-79  252.3   0.1    1.1  1  VIMSS42748  


Domain annotation for each sequence (and alignments):
>> VIMSS42748  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  252.3   0.1   2.1e-79   2.1e-79       2     218 .]     214     439 ..     213     439 .. 0.96

  Alignments for each domain:
  == domain 1  score: 252.3 bits;  conditional E-value: 2.1e-79
     UPF0051   2 qfertlivveegaevtiieeyagc............gvveifvgenAklkyvkvqnwsedavnlstkraeegrdaklelttvslggkltrkepsvelkg 88 
                 qfertli+v+ega++++i   +gc            gv+ei+v+e+A+++y+++qnws++++nl+t+ra + +   +e+++++lg+k+t+k+p ++l +
  VIMSS42748 214 QFERTLIIVDEGAQAHYI---EGCtapaynadsfhsGVIEIVVKEGARFRYSTIQNWSHNVYNLVTQRAAVYGSGVMEWVDGNLGSKVTMKYPACYLLE 309
                 89****************...555555566666666**********************************99999************************ PP

     UPF0051  89 egaeaelnglylakgkqhldtrtkvdhngpntssrilskgvlkdearavfrgkikvrkgaqktdahqenrnLllsdkaradtiPeleidaddvkasHgA 187
                 +ga++e+ ++++a+++qh+d + k+ h +p+ts++i+sk+++kd++r+++rg +k+ +ga+++++++e+++Lll+++ar dt P++ei+++d+ ++H+A
  VIMSS42748 310 DGARGEVLSIAMAGRGQHQDAGAKIVHFAPHTSGTIVSKSISKDSGRSSYRGLVKIYEGAKGSKTNVECDALLLDEEARTDTYPYIEIEEKDASVGHEA 408
                 *************************************************************************************************** PP

     UPF0051 188 tvGkideeqlfYLmsRGlseeeArrlivrgf 218
                 tv+ki++eq+ YL+sRGlse+eA  livrgf
  VIMSS42748 409 TVSKINDEQILYLQSRGLSEDEAAGLIVRGF 439
                 ******************************9 PP



Or compare VIMSS42748 to CDD or PaperBLAST