PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS501483 to PF01458 (UPF0051)

VIMSS501483 has 500 amino acids

Query:       UPF0051  [M=218]
Accession:   PF01458.17
Description: Uncharacterized protein family (UPF0051)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    2.1e-70  222.9   2.6    2.8e-70  222.5   2.6    1.2  1  VIMSS501483  


Domain annotation for each sequence (and alignments):
>> VIMSS501483  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  222.5   2.6   2.8e-70   2.8e-70       2     218 .]     237     471 ..     236     471 .. 0.96

  Alignments for each domain:
  == domain 1  score: 222.5 bits;  conditional E-value: 2.8e-70
      UPF0051   2 qfertlivveegaevtiieeyagc............gvveifvgenAklkyvkvqnw........sedavnlstkra.eegrdaklelttvslggklt 78 
                  qfert+++++ g+ v++i   +gc            +vve++v +nA++ky+++qnw        +++++n++tkra   +++ak+++t+ + g+++t
  VIMSS501483 237 QFERTILIADSGSYVSYI---EGCsapahnnyqlhaAVVEVIVLKNAQVKYSTIQNWfsghsknsQGGILNFVTKRAlCAEENAKMSWTQSESGSAIT 331
                  89****************...555556666777888***************************9777**********66688**************** PP

      UPF0051  79 rkepsvelkgegaeaelnglylakgkqhldtrtkvdhngpntssrilskgvlkdearavfrgkikvrkgaqktdahqenrnLllsdkaradtiPelei 176
                  +k+psv lkg+++ +e+ ++++++g q++dt+tk++h g+n++s+i+skg++ +++++++rg +k+ + a++++++++++++l+++k+ a+t+P++e 
  VIMSS501483 332 WKYPSVILKGKNSVGEFFSVAITNGIQQADTGTKMIHIGENSRSTIISKGISIGNSQNTYRGLVKILPTATHARNFTQCDSMLIGKKCGAHTFPNIES 429
                  ************************************************************************************************** PP

      UPF0051 177 daddvkasHgAtvGkideeqlfYLmsRGlseeeArrlivrgf 218
                  +++ ++++H+At++ki+++qlfY+++RG++e+ A ++iv+gf
  VIMSS501483 430 HNNTAQVEHEATTSKISDNQLFYCRQRGITEDNAISMIVNGF 471
                  *****************************************9 PP



Or compare VIMSS501483 to CDD or PaperBLAST