PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS520976 to PF01458 (UPF0051)

VIMSS520976 has 391 amino acids

Query:       UPF0051  [M=218]
Accession:   PF01458.17
Description: Uncharacterized protein family (UPF0051)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    2.2e-74  235.9   0.0      3e-74  235.5   0.0    1.2  1  VIMSS520976  


Domain annotation for each sequence (and alignments):
>> VIMSS520976  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  235.5   0.0     3e-74     3e-74       3     218 .]     130     357 ..     128     357 .. 0.98

  Alignments for each domain:
  == domain 1  score: 235.5 bits;  conditional E-value: 3e-74
      UPF0051   3 fertlivveegaevtiieey....agcgvveifvgenAklkyvkvqnwsedavnlstkraeegrdaklelttvslggkltrkepsvelkgegaeaeln 96 
                  f +++i ve++ae+ +  +y    ++ ++ve+ +g+nA+l+++   +w+++av+ls ++a +grda l+++ + +gg+++r  p+v+++ +g++ae+ 
  VIMSS520976 130 FGHIVIDVEANAEALVDLRYtgtgTHADNVEFLIGDNARLTVIVDASWDNTAVHLSGQQAVLGRDAVLRHNVAVFGGEVVRLVPRVKFTQPGGDAEML 227
                  6799**********9999998877666*********************************************************************** PP

      UPF0051  97 glylakgkqhldtrtkvdhngpntssrilskgvlkd.......earavfrgkikvrkgaqktdahqenrnLllsdkaradtiPeleidaddvk.asHg 186
                  g+y+a+++q++++r++vdh++p+++s++l+kg++++       +a+a++ g++++r gaq+td+++ nrnL+l+d+arad+iP+lei+++d+  a+H+
  VIMSS520976 228 GIYFADDGQYFEQRLLVDHAVPQCRSNVLYKGAIQGdknsplpDAHATWVGDVLIRSGAQGTDTYEANRNLVLTDGARADAIPNLEIETGDIAgAGHA 325
                  ************************************************************************************************** PP

      UPF0051 187 AtvGkideeqlfYLmsRGlseeeArrlivrgf 218
                  AtvG++d+e+ fYL+sRG++++eArrli+rgf
  VIMSS520976 326 ATVGRFDDEHEFYLRSRGIPQDEARRLIIRGF 357
                  *******************************9 PP



Or compare VIMSS520976 to CDD or PaperBLAST