PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS520977 to PF01458 (UPF0051)

VIMSS520977 has 459 amino acids

Query:       UPF0051  [M=218]
Accession:   PF01458.17
Description: Uncharacterized protein family (UPF0051)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    6.1e-76  241.0   0.6      8e-76  240.6   0.6    1.1  1  VIMSS520977  


Domain annotation for each sequence (and alignments):
>> VIMSS520977  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  240.6   0.6     8e-76     8e-76       2     218 .]     205     430 ..     204     430 .. 0.97

  Alignments for each domain:
  == domain 1  score: 240.6 bits;  conditional E-value: 8e-76
      UPF0051   2 qfertlivveegaevtiieeyagc............gvveifvgenAklkyvkvqnwsedavnlstkraeegrdaklelttvslggkltrkepsvelk 87 
                  qfertli+v+ega v+++   +gc            +vvei+v++nA+++y+++qnws++++nl+t+r ++++  ++e++++++g+k+t+k+p v + 
  VIMSS520977 205 QFERTLIIVDEGAYVHYV---EGCtapiyqsdslhsAVVEIIVKKNARCRYTTIQNWSNNVLNLVTQRSKVEEGGTMEWVDGNIGSKVTMKYPAVWMV 299
                  89****************...677777777777777*************************************99*********************** PP

      UPF0051  88 gegaeaelnglylakgkqhldtrtkvdhngpntssrilskgvlkdearavfrgkikvrkgaqktdahqenrnLllsdkaradtiPeleidaddvkasH 185
                  g++a++e+ ++++a+++q +dt+ k++h +p tss+i+sk+v++ ++ra +rg ++v+++a+++ +++e+++Ll+++ +r+dt P+  i++d v ++H
  VIMSS520977 300 GPHAKGEVLSAAFAGEGQIQDTGAKMQHMAPYTSSNIVSKSVARSGGRAAYRGLVRVAANAHHSVSNVECDALLVDNISRSDTYPYNDIRNDHVSLGH 397
                  ************************************************************************************************** PP

      UPF0051 186 gAtvGkideeqlfYLmsRGlseeeArrlivrgf 218
                  +Atv++++eeqlfYL+sRG+ e+eA+++ivrgf
  VIMSS520977 398 EATVSQVSEEQLFYLQSRGIAEDEAMAMIVRGF 430
                  ********************************9 PP



Or compare VIMSS520977 to CDD or PaperBLAST