PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS533365 to PF01458 (UPF0051)

VIMSS533365 has 418 amino acids

Query:       UPF0051  [M=218]
Accession:   PF01458.17
Description: Uncharacterized protein family (UPF0051)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    8.1e-65  204.6   0.5    1.2e-64  204.1   0.5    1.2  1  VIMSS533365  


Domain annotation for each sequence (and alignments):
>> VIMSS533365  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  204.1   0.5   1.2e-64   1.2e-64       2     218 .]     156     380 ..     155     380 .. 0.95

  Alignments for each domain:
  == domain 1  score: 204.1 bits;  conditional E-value: 1.2e-64
      UPF0051   2 qfertlivveegaevtiieeyagc............gvveifvgenAklkyvkvqnwsedavnlstkraeegrdaklelttvslggk.ltrkepsvel 86 
                  q+++++i+veegae+++i   +gc            gv+ei++++nAkl++++++nw+e++++ ++++++ + d+ +  ++v++     + ++p++++
  VIMSS533365 156 QNVHNIIIVEEGAELNVI---TGCttsphvksglhlGVSEIYLEKNAKLTFTMIHNWGENVHVRPRTAIKMDDDSIFINNYVTMMPVkSIQSYPTAYC 250
                  89****************...889999999999999**********************************99999999999988776255669***** PP

      UPF0051  87 kgegaeaelnglylakgkqhldtrtkvdhngpntssrilskgvlkdearavfrgkikvrkgaqktdahqenrnLllsdkaradtiPeleidaddvkas 184
                  +g++a+a++++++++kg+++ld++++v++ g+n+ ++++s+ ++ d+a+++ rg++ + +  ++ ++h e+r L+ls+++++ ++Pele+++ d ++s
  VIMSS533365 251 EGKNAKATFQTIVYGKGSSNLDMGSRVILSGENSAADMISRVIVVDDAKVISRGHL-IGA-ESNVKGHLECRGLILSNDGHILAVPELEAEKTDLELS 346
                  ********************************************************.655.89*********************************** PP

      UPF0051 185 HgAtvGkideeqlfYLmsRGlseeeArrlivrgf 218
                  H+A+vGki+e+q+ YLmsRGlse+eA +li++gf
  VIMSS533365 347 HEAAVGKIAEDQIQYLMSRGLSEDEASSLIIKGF 380
                  *********************************9 PP



Or compare VIMSS533365 to CDD or PaperBLAST