PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS5606964 to PF01458 (UPF0051)

VIMSS5606964 has 481 amino acids

Query:       UPF0051  [M=218]
Accession:   PF01458.17
Description: Uncharacterized protein family (UPF0051)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------     -----------
    9.3e-72  227.3   0.9    1.2e-71  227.0   0.9    1.1  1  VIMSS5606964  


Domain annotation for each sequence (and alignments):
>> VIMSS5606964  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  227.0   0.9   1.2e-71   1.2e-71       2     218 .]     219     452 ..     218     452 .. 0.96

  Alignments for each domain:
  == domain 1  score: 227.0 bits;  conditional E-value: 1.2e-71
       UPF0051   2 qfertlivveegaevtiieeyagc............gvveifvgenAklkyvkvqnw.......sedavnlstkra.eegrdaklelttvslggklt 78 
                   qfertliv++e++ v+++   +gc            ++vei+++ nA++ky++vqnw       +++++n++tkr   +g ++k+++t+v++g+++t
  VIMSS5606964 219 QFERTLIVADEDSYVSYL---EGCtapqrdenqlhaAIVEIIAETNAEVKYSTVQNWypgdkegKGGIYNFVTKRGvCKGDNSKISWTQVETGSAIT 312
                   89****************...666667777777777***************************777*********955588**************** PP

       UPF0051  79 rkepsvelkgegaeaelnglylakgkqhldtrtkvdhngpntssrilskgvlkdearavfrgkikvrkgaqktdahqenrnLllsdkaradtiPele 175
                   +k+ps++l+g+++ ae+++++++++ q++dt+tk++h g+nt+sri+skg++++++++++rg +k++k+a ++++h ++++Lllsd++ a+t P+  
  VIMSS5606964 313 WKYPSCVLRGDNSIAEFYSVAVTNNFQQADTGTKMIHLGKNTRSRIVSKGISAGSSQNSYRGLVKISKNAVNARNHSQCDSLLLSDHCGAHTYPYAD 409
                   ************************************************************************************************* PP

       UPF0051 176 idaddvkasHgAtvGkideeqlfYLmsRGlseeeArrlivrgf 218
                   +++d + ++H+At++ki+eeq+fY+++RG+  eeA  liv+g+
  VIMSS5606964 410 VQNDTAIIEHEATTSKISEEQIFYCNQRGIGTEEAVGLIVNGY 452
                   *****************************************96 PP



Or compare VIMSS5606964 to CDD or PaperBLAST